KEGG   Histoplasma capsulatum: HCAG_07938Help
Entry
HCAG_07938        CDS       T02229                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-1
  KO
K03259  translation initiation factor 4E
Organism
aje  Histoplasma capsulatum
Pathway
aje03013  RNA transport
Module
aje_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    HCAG_07938
Messenger RNA biogenesis [BR:aje03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     HCAG_07938
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     HCAG_07938
Translation factors [BR:aje03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    HCAG_07938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 5443356
NCBI-ProteinID: XP_001536829
UniProt: A6RE73
AA seq 241 aa AA seqDB search
MATTAENGIAVPKPANDENAAPDIASAQTKLGDTVTVFHDPNNFNVKHPLMHEWTLWFTK
PPSGKGDNWNELLKEVVTFNSVEEFWGIYNNISPTSELGLKADYHLFKKGVRPEWEDQQN
KHGGKWSYSFRDKKNVPIDDLWLHAQLAAIGETLENDNDNEVMGVVVNVRKGFYRIGLWT
RTVGKSTPEGRPAEKGKEILHNIGRKFKEVLRLKEEEILEFSGHTDSAHAGSTRAKAKFT
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccacaacggcagagaacgggatcgcggttcccaaacccgcaaacgacgagaacgca
gcccctgacatcgctagcgctcagacaaagctgggcgatactgttacagtgtttcatgac
cctaacaacttcaacgtcaaacacccgctgatgcatgagtggacgctgtggtttacgaag
ccgccaagcgggaagggcgacaactggaacgagctcctgaaagaggtcgtgacatttaat
tctgtcgaagaattctggggcatctacaacaatatcagccccacgtccgaactaggtctg
aaagccgactaccatctctttaaaaagggtgtccgtcccgaatgggaagaccagcaaaac
aaacatggcggaaaatggtcgtattccttccgcgacaagaagaacgtccccatcgatgac
ctctggctacacgcccagctcgccgctatcggcgaaaccctcgaaaatgacaatgacaac
gaggttatgggcgtcgtcgtaaacgtgcgtaagggattttatagaatcggcctatggacg
cggacagttggcaagagcacccccgagggtcgcccggcggaaaaaggcaaggagattctg
cataacatcggaaggaagtttaaggaggtgttacggctgaaggaggaggagatcttggag
ttttcaggacatacggatagtgcgcatgccggaagtacgagggcgaaggcgaagttcact
gtctga

DBGET integrated database retrieval system