KEGG   Ajellomyces capsulatus: HCAG_07938Help
Entry
HCAG_07938        CDS       T02229                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    HCAG_07938
Messenger RNA biogenesis [BR:aje03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     HCAG_07938
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     HCAG_07938
Translation factors [BR:aje03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    HCAG_07938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MATTAENGIAVPKPANDENAAPDIASAQTKLGDTVTVFHDPNNFNVKHPLMHEWTLWFTK
PPSGKGDNWNELLKEVVTFNSVEEFWGIYNNISPTSELGLKADYHLFKKGVRPEWEDQQN
KHGGKWSYSFRDKKNVPIDDLWLHAQLAAIGETLENDNDNEVMGVVVNVRKGFYRIGLWT
RTVGKSTPEGRPAEKGKEILHNIGRKFKEVLRLKEEEILEFSGHTDSAHAGSTRAKAKFT
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccacaacggcagagaacgggatcgcggttcccaaacccgcaaacgacgagaacgca
gcccctgacatcgctagcgctcagacaaagctgggcgatactgttacagtgtttcatgac
cctaacaacttcaacgtcaaacacccgctgatgcatgagtggacgctgtggtttacgaag
ccgccaagcgggaagggcgacaactggaacgagctcctgaaagaggtcgtgacatttaat
tctgtcgaagaattctggggcatctacaacaatatcagccccacgtccgaactaggtctg
aaagccgactaccatctctttaaaaagggtgtccgtcccgaatgggaagaccagcaaaac
aaacatggcggaaaatggtcgtattccttccgcgacaagaagaacgtccccatcgatgac
ctctggctacacgcccagctcgccgctatcggcgaaaccctcgaaaatgacaatgacaac
gaggttatgggcgtcgtcgtaaacgtgcgtaagggattttatagaatcggcctatggacg
cggacagttggcaagagcacccccgagggtcgcccggcggaaaaaggcaaggagattctg
cataacatcggaaggaagtttaaggaggtgttacggctgaaggaggaggagatcttggag
ttttcaggacatacggatagtgcgcatgccggaagtacgagggcgaaggcgaagttcact
gtctga

DBGET integrated database retrieval system