KEGG   Ajellomyces capsulatus: HCAG_07938Help
Entry
HCAG_07938        CDS       T02229                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:aje03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MATTAENGIAVPKPANDENAAPDIASAQTKLGDTVTVFHDPNNFNVKHPLMHEWTLWFTK
PPSGKGDNWNELLKEVVTFNSVEEFWGIYNNISPTSELGLKADYHLFKKGVRPEWEDQQN
KHGGKWSYSFRDKKNVPIDDLWLHAQLAAIGETLENDNDNEVMGVVVNVRKGFYRIGLWT
RTVGKSTPEGRPAEKGKEILHNIGRKFKEVLRLKEEEILEFSGHTDSAHAGSTRAKAKFT
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccacaacggcagagaacgggatcgcggttcccaaacccgcaaacgacgagaacgca
gcccctgacatcgctagcgctcagacaaagctgggcgatactgttacagtgtttcatgac
cctaacaacttcaacgtcaaacacccgctgatgcatgagtggacgctgtggtttacgaag
ccgccaagcgggaagggcgacaactggaacgagctcctgaaagaggtcgtgacatttaat
tctgtcgaagaattctggggcatctacaacaatatcagccccacgtccgaactaggtctg
aaagccgactaccatctctttaaaaagggtgtccgtcccgaatgggaagaccagcaaaac
aaacatggcggaaaatggtcgtattccttccgcgacaagaagaacgtccccatcgatgac
ctctggctacacgcccagctcgccgctatcggcgaaaccctcgaaaatgacaatgacaac
gaggttatgggcgtcgtcgtaaacgtgcgtaagggattttatagaatcggcctatggacg
cggacagttggcaagagcacccccgagggtcgcccggcggaaaaaggcaaggagattctg
cataacatcggaaggaagtttaaggaggtgttacggctgaaggaggaggagatcttggag
ttttcaggacatacggatagtgcgcatgccggaagtacgagggcgaaggcgaagttcact
gtctga

DBGET integrated database retrieval system