KEGG   Ajellomyces capsulatus: HCAG_08071Help
Entry
HCAG_08071        CDS       T02229                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aje  Ajellomyces capsulatus
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HCAG_08071
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    HCAG_08071
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     HCAG_08071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 318 aa AA seqDB search
MTPILAAARYGKDNVRVYKVHRNEETGFHTVVEMTVCVLLEGDIETSYTKADNSVVVATD
SMKNTIYIMAKLHPVTPPELFASILGSHFTTTYPHIHTAHVDIVILRWTRMTFDGKPHPH
SFLRDGTETRNVSAIVSEGNSGSKDITSLTSTISLTSSISGLSVLKSTNSQFHNFIRDEY
TTLPETWDRVLSTNVDANWTWQPFTSVDAVKRAVPQFDETWRAARDITLRIFAHDNSASV
QNSMYKMAEQILAVQPLLETVEYSLPNNHYFELDLSWHKGLKNTGKNAEVYVPQSGPNGL
IKCKVGRAGGNRRETPKL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgatattggccgcagcacggtatggcaaggataatgtccgcgtctacaaggtg
catcgcaacgaggagacaggcttccacaccgtcgttgagatgacagtatgcgtcctgctc
gaaggggatatcgagacgtcttacaccaaagccgacaacagcgtcgtcgtcgccacggac
tccatgaaaaacacaatttacatcatggccaagctgcacccggtgactccgccggaactc
ttcgcctccattctcggttcccacttcacaaccacatacccgcacatccacaccgcgcac
gtcgacatcgtcatcctccgctggacacgtatgacatttgatggaaaaccacatccccac
tccttcctccgcgacggtacggaaacccgcaacgtctccgccatcgtctccgaaggaaac
agcggcagcaaagacatcacctcactaaccagtacaatcagcctaacctcctctatctcg
ggcctctccgtcctaaaatccacaaactcacaattccacaacttcatccgggacgagtac
accacgctccccgaaacctgggaccgggtgctaagcaccaacgtcgacgccaactggacg
tggcagcccttcacgtccgtcgacgccgtgaagcgcgcggtaccccagttcgacgaaacc
tggcgcgccgcgcgggacatcacgctgcgcatctttgcgcatgataacagcgccagcgtg
cagaattccatgtacaagatggcggagcagatcctggctgtgcagccgttgctggagact
gtggagtattcgttgccgaataaccactattttgagctagacttgagttggcacaagggc
ctcaagaacacgggtaaaaacgcagaagtttacgtaccgcagtcgggcccgaatggtctt
atcaagtgcaaagtgggccgggccggaggaaaccgtcgggagacgccgaagttatag

DBGET integrated database retrieval system