KEGG   Ajellomyces capsulatus: HCAG_08094Help
Entry
HCAG_08094        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
aje  Ajellomyces capsulatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2246 aa AA seqDB search
MAQAASGTDAAQRIFHELKSKNEETRSRASYELHDNVIAVSRELPPDKFIEYYNAVSQRI
AQLVVTGNDANEKIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDNTVLIYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQENRRFAAVLVIRELAKGSPTLLYGFVPQ
IFELIWVALRDPKVLIRETSAEAVSECFEILAARDVQVRQQWFGRIYEETLQGLRSSNVD
WIYGSLLTLKELLLKGAMFMNEHYRNACEIVLRLKDHRDPKIRTQVVLTIPILASYAPLE
FTNVYLHRFMIYLQAQLKRDKERNAAFIAIGKIANAVGNSIGQFLDGIIVYIREGLTMKA
RNRAAVNEGPMFECISMLSLAVGQTLSKYMEALLDPIFACGLSESLTQALVDMAHYIPPI
KATIQEKLLDMLSIVLSGSPFRPLGCPENRPPPMPSFAKDYGAFLQEPTDSEIALALHTL
GSFDFSGHILNEFVRDVAINFVHRDNPEIRKASALTCCQLFVHDPIINQTSSHSIQVVSE
VIDTLLSVGVGDPDPEIRRIVLESLDQKFDRHIAKPENVRCLFLAVNDEVFSVREAAISI
IGRLSSVNPAYVFPPLRKLLVNLLTGLSFATTSRQKEESAQLISLFVANATKLVRSYVDP
MVKALFPKTTDPNAGVASTTLKAIGELATVGGEDMKQYLPQLMPIILEALQDLSSQSKRE
AALRTLGQLASNAGYVIEPYIEYPNLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYK
HQQIIESSPDIHHVNEVQTVSDVSLIMQGLTPSNDEYYPTVVINTLLQNILNESSLSQYH
SAVIDAIVTIFKTLGLKCVPFLGQIIPSFLSVIRSTPTSRLESYFNQLAIIVTIVRQHIR
TFLPEIIEVIREFWDCSYQVQATILSLVEAIAKSLEGEFKKYLAGLIPLMLDTLEKDNTP
RRQPSERILHTFLIFGPSGEEYMHLIVPAIVNVSDFASLMIHPLSRVIAGGDRTLRQTAL
DCICTLIFQLGQDFNNYIQLMNKIIQTHQINHHNYQVLVSKLQKGDPLPQDLNPDEHYGA
LGDDATFADILLNLAEFMEHDDKALHIDIRTLGKYAGKCHAFAKALHYKELEFEQDQNSG
AVEALISINNQLQQSDAAIGILRKAQAYRDVELKETWFVKLQRWEEALAAYKRRELIDPD
SFDVTMGKMRCLHALGEWKMLSDLAQEKWNQASNEHRKAMAPLAAGAAWGRGQWELMDSY
IGVMKEQTPDRSFFGAILAIHRNQFDEAAMFIEKARNGLDTELSALLGESYNRAYNVVVR
VQMLAELEEIITYKQNASDPEKQEAMKETWNKRLLGCQQNVEVWQRMLKVRALVVCPREN
LDMWIKFANLCRKSNRMGLADRSLSALESCKGSDQPTPPEVIYARLKYDWTAGRQKEALQ
MLREFTIGLTEEFSRYSSVLIAHGEHASSDRPGLVNGITDHPDLATARQHIGEMGKFRRL
LAKSYLKQGEWQTALQKGDWTSEGVRDVLNSYSAATQYNLDSYKAWHAWALTNFEVVNAL
SAQTNRETFVPHHMVLEHVIPAIRGFFRSISLSSTSSLQDTLRLLTLWFNHGGDAEVSGV
VTEGFSSVSVDTWLEVTPQLIARINQPNARVRGSVHRLLAEVGKAHPQALVYPLTVATKS
NVVRRSQSATHIMDSMRQHSPRLVEQAEIVSHELIRVAVLWHELWHEGLEEASRLYFGDH
NVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEAKHFCILYRESGVIGDLNQAWD
LYYTVFRKIARQLPQLSTLDLKYVSPKLKDAVDLELAVPGTYQSGKPVIRIMSFDPVSTV
MQTKKRPRKMTLKGSDGNSYMYVLKGHEDIRQDERVMQLFGLVNTLLDHDSESFKRHLTI
QRFPAIPLSQNSGLIGWVCNTDTLHALIKEYRESRRILVNIEHRIMLQMAPDYDNLTLMQ
KVEVFGYAMDNTTGKDLYRVLWLKSKSSESWLERRTNYTRSLGVMSMVGYILGLGDRHPS
NLLLDRITGKIVHIDFGDCFEIAMHREKYPERVPFRLTRMLTFAMEVSNIEGSYHITCEA
VMRVIRENKESLMAVLEAFIHDPLINWRLGARESPARPSFPTDRRQAIADEISVEHPVQP
SNFSRRRPSILEGGILDAQQGVPNEAREVQNARALQVLSRVKEKLTGRDFKSTEELNVSD
QVDKLLVQATSVENLCQHYIGWCSFW
NT seq 6741 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcagcttcagggacagacgcggcccagcgcattttccacgaactgaaatcc
aagaacgaagaaacccgctcccgcgcatcatacgaactccacgataatgtcatcgctgtc
tctagagagctgccaccggataagttcatcgaatattacaatgcggtctctcagcgtatc
gcccaacttgttgttaccggaaatgatgcaaatgagaaaattggcgggcttcttgctctc
gataggttgatcgactttgatggcgtcgatgctgctcaaaagaccacccgtttcgccagc
tacttacgaagtgcactacggagcaacgataacacagtcttaatatatgcagcgcgctca
ctcggtcgtctggccaaacctggtggtgctttgactgcggagttagtggaaagcgaaatt
cagtccgcattggaatggctacagtccgaaagacaagaaaataggcggtttgctgcggtc
ctagtcatccgggagcttgcaaaaggttcaccgactcttctctacggcttcgtcccacag
atattcgagcttatctgggtggcattgagagatccaaaagttctcattcgtgagacctct
gccgaagccgttagcgagtgttttgaaatattagcagcgagggatgtccaggtccgtcaa
caatggtttggtcgaatttacgaggagactttgcagggcctaaggtccagtaatgttgac
tggatttatggctcgcttctcaccttgaaagaactcctcttgaaaggtgctatgttcatg
aatgagcattatcgaaatgcctgtgaaatagtcctacgcctcaaagaccaccgtgatccg
aagattcgaacacaggtcgtccttaccatccccattctagcgtcatatgcgcctctggaa
tttacaaatgtatacctacatagattcatgatatatttacaagcacaattaaagcgggat
aaggagcgaaatgctgctttcattgccatcggaaaaatcgcgaatgccgtgggtaattct
atcgggcagtttcttgatgggattattgtgtatatccgggaagggttaacaatgaaagct
cgtaaccgtgcagcagtcaatgaaggtccgatgttcgagtgcatcagcatgttatcactg
gctgtcggacaaacgcttagcaaatacatggaggccttacttgacccaattttcgcatgc
ggattaagcgagtctcttacgcaggccttggtagatatggcgcactatatacctccaatc
aaggcaacaattcaagaaaaattacttgacatgctaagcatagtcctgtcgggctctcca
ttccggcctcttggctgcccggaaaaccgcccacctccaatgccttcatttgcgaaggac
tatggagcttttctgcaggagccaaccgacagtgaaattgcccttgcattgcacacgctt
ggcagctttgacttctctgggcatattttgaacgaatttgttcgtgacgttgctattaat
ttcgtccatagggacaatccggaaatccggaaagcgtctgcgttaacgtgttgtcaactt
tttgtccacgaccctatcattaatcagactagtagtcactcgatccaagttgttagtgaa
gtcatagatactctcctctctgttggagtgggagatccagatccagaaattcgtcgaatc
gtcctagagtcgttagatcagaaattcgaccgtcatatagccaaacctgaaaatgttcga
tgcctgttcctcgcagtgaatgacgaagtattttcggttcgggaagctgcaatcagtatt
attggacgtctttccagtgttaatccggcatacgtttttcctccattaaggaaattgttg
gtgaatttgttgactggactcagctttgctaccacatctcgccagaaggaggaaagcgcg
caactaatcagcttgtttgttgcgaatgctacgaaactcgtccgatcctatgttgacccc
atggtgaaagctttatttccgaaaacaactgatccaaatgctggagttgcatcgacaact
ttgaaagccattggtgaacttgcgacagtcggtggtgaggatatgaagcaatatttgccg
cagctcatgcccattatcctggaagcacttcaggatttatcatcccaatctaagcgagaa
gcagcattacgaacactaggccaacttgcaagtaatgctggttatgtcatcgagccttat
attgaatatccaaatctcctcgctgtcctgattaacattataaaaaccgaacaaactgga
tctctgagaaaggagactataaagttgcttggtatcctcggcgctttggatccatacaaa
caccagcaaataattgaatcctcgcccgatatccatcacgtaaatgaagtccaaacggta
tcggacgtttcccttatcatgcaaggcctcaccccctctaacgatgagtattatcccact
gtcgttattaacaccctccttcaaaatatcctcaacgaaagttctctctcccaataccac
tctgctgttatcgatgccattgttaccatattcaaaaccttggggttgaaatgcgtgcca
ttcttagggcaaattataccttctttcctctccgttattcgaagtactcccaccagtcgg
cttgaatcttatttcaaccaattagcaatcatagtgaccattgtcagacaacacatccga
acctttttgccagaaatcattgaggtcatccgtgaattctgggattgctcttaccaagtc
caagccacaatattatctcttgtcgaggcaattgcaaagtccttggaaggagaattcaag
aaatacttggcaggcctgatcccgcttatgcttgacaccttagagaaggataatacacca
agacggcagccatcagaaagaattttacacacctttttgatatttgggccgagcggggag
gaatatatgcatctaatcgttccggccattgtcaacgtgtccgatttcgcttctcttatg
atacatccactgtcaagggtgattgccggtggtgaccgtaccctacggcaaaccgccctg
gattgtatctgcacgcttatattccagctagggcaggacttcaacaactacatccagctc
atgaacaaaattattcaaacccatcaaataaatcatcacaactaccaagttcttgtttca
aaattacagaagggggatccactccctcaagatctaaaccctgacgagcactatggagcg
cttggtgatgatgctacgttcgccgatatccttcttaatcttgcagaattcatggaacat
gacgacaaggcattgcatatcgacatccgaaccctcggcaagtatgccggaaaatgccac
gccttcgccaaagctcttcattataaggaattggaattcgaacaggatcaaaattcaggc
gcagttgaggcattaatcagcattaataatcaacttcaacaatcagatgctgcgattggt
attcttcgtaaagctcaggcgtacagagatgttgagctcaaggaaacgtggttcgtcaag
ctacaacgttgggaggaggcgctggctgcgtataagaggcgcgagcttatcgacccagat
tcattcgatgttacaatgggaaagatgcgttgtctgcatgcactcggtgaatggaaaatg
ctttctgatctcgctcaggaaaagtggaaccaagcctccaatgaacatcgaaaggccatg
gcgcctcttgctgcgggcgcggcctggggccgtggccaatgggagcttatggactcatat
atcggagtaatgaaagaacaaactcctgaccggtcattttttggtgcgattctggctata
catcgcaatcaattcgacgaagcggcgatgttcattgaaaaagcacgaaatggcctggat
actgaactttcggcattgctgggagaatcttataaccgtgcctataacgtcgttgttcgt
gttcaaatgcttgcagaactcgaagaaataatcacatataagcagaacgctagtgatcct
gagaaacaggaggcaatgaaagaaacatggaataaacgactccttggttgccagcaaaac
gtcgaggtatggcaacgcatgctcaaagtaagagccttagtcgtatgtcctcgtgagaat
ttggatatgtggatcaaatttgcgaatttatgccgcaagtcaaatcgcatgggtctggca
gatcgttctctaagcgccttagaaagttgtaagggatcagaccaaccgacgccaccagag
gttatatacgctcgactcaagtatgactggactgctggacgccaaaaagaggcactgcag
atgttacgggaattcactattgggttgactgaagaattctcgcgatatagctctgttctc
atcgctcatggtgagcatgcttcttcagacaggcccggccttgtcaatggcattaccgac
catcctgacctggccactgcacgtcaacatatcggtgaaatgggtaaatttcgacgacta
ctggcaaaaagctatttgaagcaaggtgaatggcaaacagcacttcaaaaaggagattgg
acttcagaaggagtacgagatgtcttgaattcgtattcagcagctacacaatataatctt
gactcctacaaagcgtggcacgcctgggcattgacaaattttgaggttgtaaacgcattg
agcgctcaaacaaatcgggaaaccttcgttccccatcacatggttcttgaacatgtcatt
cctgctattcgaggttttttccgctctatttccttgtcgtcgacaagttcactgcaagac
actttgaggcttctcaccctttggttcaaccatggtggcgatgccgaagtaagcggtgtg
gtcactgaaggattctcttcagttagcgtcgatacatggctagaggtcacacctcagctc
atcgcacgtatcaatcagccgaatgcacgggtaaggggatctgtccatagattacttgcg
gaagttggaaaagcccacccacaggccctggtttatcctctgactgtagcaacgaaatct
aacgttgtgagacggtctcaatctgctacgcatattatggatagtatgaggcaacatagc
cccaggcttgttgaacaagcggaaattgtcagtcacgagttgattcgtgtcgctgtctta
tggcacgagctttggcatgaaggtttagaggaagcttctcgattgtactttggagatcat
aatgtcgaagggatgtttgcgacattggcacctttacatgatatgcttgataagggtgcc
gaaacgcttagggaagtttcctttgctcaggcatttggccgtgaccttgcagaggccaag
catttttgcattctttaccgcgaatcaggagttataggtgatctcaaccaggcctgggat
ctatactacactgtcttccggaaaattgctcgtcagctccctcagctgtctactctagac
ctgaaatacgtctcccctaaacttaaggacgccgttgaccttgagttggctgttcctggc
acgtaccagagcggtaagcctgtgattagaatcatgagcttcgatccagtgtccaccgtg
atgcagaccaagaaacgaccccgcaaaatgacattgaaaggtagcgacggaaattcatat
atgtacgtcctcaagggccacgaggacatccggcaagatgagcgtgtcatgcaacttttc
ggacttgtaaataccctccttgatcatgacagtgaaagcttcaagcgccatctcacaatt
caacgcttccccgctattccactatcgcagaactctggcttaattgggtgggtttgcaac
actgacacattgcacgctctgatcaaagaataccgtgaaagccgacggattctagttaat
atagagcatcgtattatgctacaaatggccccagattatgacaacttaacgcttatgcaa
aaggttgaagtatttggatatgccatggacaacacgactgggaaagatctataccgagtc
ctttggctcaaaagcaagagttctgaatcttggcttgagagacgaacgaactataccagg
tcgcttggagttatgtccatggttggatatattctcggcttgggcgaccgtcacccgtca
aatcttttactcgatcgcattaccggcaaaatcgtgcatattgatttcggcgactgcttc
gaaattgcgatgcatcgtgaaaaatatcctgaacgtgttccattccgtcttacccgaatg
ctcacctttgctatggaggttagcaatatcgagggtagttatcacatcacctgtgaggct
gtaatgcgagtcatccgagaaaacaaggagtctttgatggccgtattggaagcgttcatc
cacgatcccctcataaactggcgcctaggcgctcgggaatcacccgctcgaccatccttc
cccacggaccgccgccaagctatcgccgacgaaataagcgtcgaacatcctgtgcaaccc
agcaatttctccagacgacgcccatcgattcttgaaggaggcatccttgacgcgcagcag
ggcgtgcccaatgaagcacgggaagtgcagaatgcacgagctctccaggttctttcgcga
gtgaaggagaagctaacgggacgcgatttcaaatcgacagaggagctgaatgtttccgac
caggtggataagttgttagtccaagctacgagtgtggaaaatctttgccaacattacatt
gggtggtgtagcttttggtga

DBGET integrated database retrieval system