KEGG   Ajellomyces capsulatus: HCAG_08151Help
Entry
HCAG_08151        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aje  Ajellomyces capsulatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HCAG_08151
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HCAG_08151
Enzymes [BR:aje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HCAG_08151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 876 aa AA seqDB search
MGFDGTSVNSEIRSLIEDYHLGSVILTAKNLKSAEETTKLVYELQTIARDAGHPVPLLIC
LDQENGGVNTLFDEIYIRQFPSAMGMAATGSKSLAREVCKATAQELSAVGINWILGPVLD
ALTNARNQPLGVRSVGDDPQEVSAYGIEFMKGYQEAGLVTCGKHFPSYGNLDYMGSQSDV
PIITDTIEQLSVSALVPYRNAITHGIDSMMVGGCSMASAGMTVMHACLSEQVVDELLRKD
LKFDGVVVSECLEMEALSYNIGVGGGTVMAMKAGCDLILLCRSFSVQQEAINGLKLGVEN
GIISKSRIRESLRRVLDMKSRCTSWEKALNPPGISLLSKMQPSHTSLSTRAYSSSLTVVR
DKHNNIPLSSVLEPDEELLLLTPLIKPLPASAMLLSMTTEASRAGLSADAASWERSASVM
SGESVFKEFGRSLARQRNGRVLHTSYTANGVRPVHENLIDRASAVIIVTADANRNLYQNG
FTKHVSLMCNSQFSSNGERRAKPVIVVAVSSPYDFATDPSIGTRNQRLQQSRQHWLVENW
NEDRDAHALDTLVDIVREDGTQCQRSELASVTSTTFLLRNSDVEESHFVVRNSSTQALYG
FCSTYYFKSTGTGVIGALIVDPSRRRMSIGHSLHNRAIRTLIQRPGIRSFQLGSRLPGIY
HGIPTGNPTERKRLRQWFANLGWNTALSRSVCSMMLRNLEDWSPPEGLTKVLQSSEVDYD
LVYGWEFADSVLDHVKTTSRVGVMEIYKRGLGGAPGSGIIRAKRREDGTILGSVVVYNST
SALAESMPALKDTRTIAGGISCPVISPSVGEYATLVQGLILLGIKQIRKQGARAAILDCV
DADGNYDSLSAMGFSVLHSFEEVTCDASTWSMMAAS
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgatggaactagcgttaattcggaaatccgctcgctgatagaggactatcat
ctgggttctgtcatactcaccgctaagaacttgaaatcggcggaagaaaccactaaactt
gtctatgaactacaaaccatcgcccgggatgctggccatccggtcccgttactgatttgc
ctcgatcaggaaaatggcggcgttaacactttattcgacgagatttacatacggcagttc
cccagcgccatggggatggctgcgacaggctcgaaatctctagcaagagaagtctgcaag
gccactgcccaagagctcagcgccgttggtatcaactggatccttggtcccgtgcttgat
gcgttgacgaatgccagaaaccagcccctaggcgttcgaagcgtaggagatgacccgcaa
gaggtgtccgcgtacggcattgagttcatgaaaggctatcaagaggcaggcttggtgact
tgcgggaagcatttcccctcatatggtaatctcgattatatgggttcccagtctgatgtt
cccatcatcacggatactattgagcaactaagtgtgagcgcactggttccttatcggaat
gcgataacgcatggcatagattcaatgatggtaggaggatgttccatggcatcagctgga
atgactgtcatgcatgcttgtttgtcagaacaggttgttgacgaactcctgcggaaggac
ctaaaattcgacggtgtggtcgtttcggaatgccttgagatggaagcactcagctacaat
ataggcgttggcggtggaacggttatggccatgaaggccggttgcgacctgatcctgttg
tgtcgatccttctctgtacaacaggaggctatcaatggattgaagctaggagtagaaaat
ggcatcattagcaaaagccgcatacgtgagtcactacgaagagtgctggacatgaagtcg
cgatgcacttcgtgggaaaaagctttgaatccaccaggaatcagccttttatcgaaaatg
cagccgtcccacactagcctatccactcgagcgtatagcagctcgctcaccgttgttaga
gacaagcacaataacatcccgttatccagcgttctcgaaccggatgaggaacttctgctc
ctcacaccattgataaagccgttaccagcatctgcaatgctactatcgatgaccaccgaa
gcaagtcgggcaggcctatcagcggatgccgcatcatgggagcgtagtgcttctgtcatg
agcggtgaaagtgttttcaaggagtttgggcgatcgttagctcggcagaggaacgggcgt
gttttacacacctcctacactgccaatggcgtccgaccagtccatgaaaatttaatcgat
cgcgcaagcgctgtcataattgtaacggccgacgccaacagaaacttgtaccagaatgga
ttcacgaaacacgtatcgctaatgtgcaattctcaattttcttccaacggcgagcgccgc
gcgaaacccgtaatcgttgtagctgtcagctcgccttacgatttcgccacagatccatca
attgggactcgcaaccagagactccaacagtcgaggcaacattggctagtggagaactgg
aatgaggatcgggatgcacatgccttagatactctcgtagatattgttcgagaagatggt
acccagtgccaaagatccgaacttgctagcgttacctccaccaccttccttctccgcaac
agcgacgtggaagaatcccactttgttgttcgaaatagcagcacacaggcgctctatgga
ttttgttctacgtattacttcaaatccacagggacgggcgtgatcggtgcactcattgtc
gacccttcccgccgacgaatgtccatcggccattccctccataaccgcgcaattcggaca
ctgattcaacggccaggcatccgtagcttccagctcggctcacgtttaccaggcatatat
catggaatccctacaggaaaccccaccgagcgcaaaaggcttcggcagtggtttgccaat
ctggggtggaacactgccctctcccgttctgtatgcagcatgatgttacgaaatctcgaa
gactggtcaccgccggaaggattgacgaaagttctacagagctcggaagtcgactacgat
ctcgtttatgggtgggagtttgcggattctgtccttgatcatgtgaaaactacttcgcgt
gttggggtcatggagatctacaaaagggggcttggcggtgctccgggtagcgggattatt
cgcgctaaacgccgggaagatgggacaatactgggtagtgtcgttgtgtataattccacg
tccgcgcttgcggaatccatgccggcgcttaaggatactcgcacaattgcgggagggatt
tcttgtcctgtgatctctccttctgtcggggagtatgcaacactggtacagggattgatc
ttgttgggaatcaagcagattcgcaagcaaggggctagggcggctatactggattgtgtc
gacgctgatgggaactacgatagtctctctgccatgggattttccgtcctgcatagtttc
gaggaagtcacctgcgatgcttccacctggagtatgatggctgcctcatga

DBGET integrated database retrieval system