KEGG   Ajellomyces capsulatus: HCAG_08231Help
Entry
HCAG_08231        CDS       T02229                                 

Definition
similar to protein phosphatase 3
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aje  Ajellomyces capsulatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 155 aa AA seqDB search
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDMQLQQIVDKTIMEADKDGDGKISFEEFTRMVENTDVSMSMTLETCDVEMGG
HCSNSQRIYNHLSLQLTAYRNTVTLGGLFQSPKIV
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgattgccatattcgacgaagacggaggcggcgacgtggacttccaagagtttgtctcg
ggactatcagccttcagctcgaaggggaataaagaggagaagctgcgctttgcctttaaa
gtctacgatatcgaccgcgatggctacatttcgaacggagagctgttcattgtcttgaag
atgatggtcgggagcaacttgaaggatatgcagctgcagcagatcgtggataagacgatt
atggaggctgataaagatggcgatgggaagattagttttgaggaatttacgcgcatggtg
gaaaatacggatgtcagcatgagcatgactttggagacttgtgatgtagaaatggggggc
cactgctcgaacagccaaagaatttacaaccatcttagcttgcaactaaccgcctaccgc
aatacagtgaccctcggtggtctttttcagtcacctaaaattgtttga

DBGET integrated database retrieval system