KEGG   Ajellomyces capsulatus: HCAG_08357Help
Entry
HCAG_08357        CDS       T02229                                 

Definition
bifunctional pyrimidine biosynthesis protein pyrABCN
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
aje  Ajellomyces capsulatus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aje00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aje00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2404 aa AA seqDB search
MPLLNAAGDTKSSIVQPNAVRGGWLTDSSAAHPSGPAARGVVAYTPNRDLPSIASRTAYS
LNDGAIPPASPPKVGAEGNGSKWYALELEDGTVYQGYSFGADKSIAGELVFQTGMVGYPE
SITDPSYRGQILIITFPLIGNYGVPSRETVDELLGKQLPKYFESSEIHVAGLVVANYSGE
DYSHYLAESSLGQWLKDQGVPAMHGVDTRSLTKRIRENGSMLGRMLLQKSDVSVETLNGD
APRNGLAAAAVDDEGGSDLWRASFESIEWADPNKRNLVNDVSIRNPRLFSPPTDSTLFHP
SGRPIRVLCVDVGMKYNQLRCLLSRGVEVLVVPWDYDFPRLAGKEYDGLFLSNGPGNPAT
LSKTVENIRIATEDSRTPIFGICLGHQLLARAAGASTIKMKFGNRGANIPCTSLISGRCY
ITSQNHGYAVDSMTLAEGWEELFVNANDGSNEGIRHVTRPFFSVQFHPESAPGPQDTEFL
FDVFIDAIKRSMISPSALAEPVSFPGATAEENELRSPRVNVRKVLILGSGGLSIGQAGEF
DYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVNADFVRKVINHERPDAI
YVTFGGQTALQVGIQLKEEFEKLGIRVLGTPIDTIITTEDRELFARSMESIDEKCAKSAS
ASTLEEAMEVVKDIGFPVIVRAAYALGGLGSGFAEDPDQLRELCMKAFAASPQVLIERSM
KGWKEIEYEVVRDARDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVN
VIRHLGVVGECNIQYALNPFSREYCIIEVNARLSRSSALASKATGYPLAFVAAKLGLGIP
LNEISNSVTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFE
EAIQKAIRSVDFHNVGFNETNALMSIKAELQTPSDQRLFAIANAMHSGYSVDDIWELTKI
DKWFLRKLKGLSDFGKFMSGYNATTAPVSLIRQAKQLGFSDRQLSKFLSSNELAIRRLRV
EAGIVPVVKQIDTVAAEFPAFTNYLYLTYNGSEHDVDFNDQGVMVLGSGVYRIGSSVEFD
WCSVRTIRTLREQGYKTVMVNISRKLLKVLCCSASTSLVPGCSGDNSIAMASPVFSASTA
LKLIMSVVWKCLCYARPRFKHPLLARFFDTQEELEATAEGISLSFASGLFDVLITVKFNP
ETVSTDYDEADRLYFENINLETVLDIYQLESSSGVIISMGGQTPNNIALPLYRLNVNILG
TSPEMIDTAENRYKFSRLLDHIDVDQPAWKELTSIEEATAFCAKVGYPVLVRPSYVLSGA
AMNTVYSLDDLANYLNQAAEVSREHPVVITKYIESAKEIEMDAVARNGVLVGHFISEHVE
NAGVHSGDATLILPPQDLDPETVRRIEEATRKIGNALNVTGPFNIQFIAKDNDIKVIECN
VRASRSFPFVSKVMGVDLIEMATMAMIGKPFTEYPPVTIPKKYVGVKVPQFSFSRLSGAD
PVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPKKNVLFSIGAFKEKVEMLPSIRKL
HALGYNLFATAGTADYLKEHGLPVKYLDVLAGEEEDLKSEYSLTQHLANNLIDLYINLPS
SNRFRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKLLIEAIARHYSMNVMSIDCQTSYR
AVILPGLINVAAFVPGLANPDSPDFQVVTKASIANGFSMVRIMPVGVDSFVTDSQALRTA
QHNSSKGSYCDFNLSVTATSTNSEKVGLITSEVGSLFIPFNHLAGNINKVATVTSHFASW
PTNKPIITDAKATDLASILLLASLHNRNIHVMSVTSKEDIGLIALSKEKGLKVTCDVAIY
SLFLSTDDFPGCACLPSKKDQEALWEHLDSIDIFSIGSLPYQVAGKNASPAVGIQDALPL
LFTAVSDKRLTVEDITSRLHDNPKRVFELHDQPDASVEIEFDRPYVFQGHDVWSPFAGTT
LKASVRRVTFQGKTSCLDGKVIPDAPRGTDMSAHRLTPPPQGSPAVKDILSTSPRPESAL
GRRLSFSATPLQRPTRFKPNAPDGYAPSASGDEFVTVAPMYPYPSQVSPSLQQLLSQSSF
KQKHILSVGQFTRTDLHLLFTVAQEMRLGVQRHGILDILKGRVLTTLFFEPSTRTSASFD
AAMQRLGGRTIPVSTEHSSTQKGETLQDTVRTLGCYSDAIVLRHPDDSSAATAAKFSPVP
IINAGNGAVEHPTQAFLDLFTIREELGTVNDITITFTGDLKYGRTVHSLVKLLQFYEVRI
QLVSPKALAIPEEVRQQLVLSGQLILESTELTPEIIARSDVLYCTRVQKERFKDSNEYEQ
LKNVFVIDNTVLKHAKSQMIVMHPLPRNQEVCEEVDFDQRAAYFRQMKYGLYCRMALLAL
VMAS
NT seq 7215 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttctcaatgccgctggggacaccaagagctctattgtccagcccaatgctgta
aggggaggatggctaactgattcttctgccgctcatccttctggtcctgctgctcgcggc
gtcgtcgcatacaccccgaatagagacctgccatccattgcttcccgaaccgcttattct
ctcaatgacggtgcgatccccccagcgtctcctccgaaggttggtgcggagggaaacggg
agcaagtggtatgccctagagttggaagatggcactgtctaccagggctacagctttggt
gcggacaagagcattgccggcgagttggtatttcaaaccggcatggtgggctacccagaa
tcgatcacagacccttcctaccgtggccagatcttgatcattacttttcccctgataggc
aactatggtgttccctcgcgtgaaacggtcgatgaacttctcggtaaacaactacccaaa
tatttcgagtccagtgagatccacgtcgctggccttgtggtggcaaactactctggagag
gattactcccattatctagctgagtcgtctctcggtcaatggctgaaagatcaaggagtg
cctgccatgcatggcgtcgatactcgctccctcaccaagagaattcgagagaatgggagc
atgcttggccgcatgcttttgcagaaatccgatgtcagcgttgaaaccttgaacggcgac
gcaccgagaaacggcttggcagcagcagcagttgatgacgaaggaggatctgatctttgg
agagcatcatttgagagtattgaatgggcggaccctaataagaggaaccttgttaacgat
gtgtctatcaggaatccccgtttgttttccccgccaacggattcaacgctttttcaccct
tctggtcgcccgattagagtcctgtgtgttgacgttggtatgaaatacaaccaactaagg
tgccttctctctcgcggcgtcgaagtgctggtcgtcccctgggattacgattttcccaga
ttggccggaaaggaatatgacggcctgttcctttcaaacggcccaggtaatcccgctacg
ctttcaaaaacagtggagaatattagaattgctaccgaggactcccggactccgatcttt
ggtatttgtctcggacaccaattacttgcacgtgctgctggtgcatccaccattaagatg
aagtttggtaaccgcggtgcaaatatcccttgtaccagtcttatatctggtcgctgctac
attacctctcaaaaccacggatatgcagttgattccatgactttggcagagggctgggag
gaactcttcgtcaatgctaatgatgggagcaatgaaggcatcagacacgttacccgccca
ttttttagcgtccaattccatccggagagcgctccaggaccccaggacacagagttcttg
ttcgatgttttcatcgatgctattaagagaagcatgatatcgcctagtgccctagcagag
cctgttagcttccctggcgccactgccgaagagaatgagcttagaagcccgagagtcaac
gttaggaaagttttaatcctcggtagcggtggtctcagtatcggacaagctggagagttt
gactattctggaagtcaagccataaaggccttgaaggaagaaggaatttacaccatcctc
atcaatcctaatatcgcgacgattcaaacttccaagggcctggcggataaggtctacttc
ttgcctgtcaacgcggactttgtccgcaaggttatcaatcacgaacggccagatgccatc
tacgtaacattcggcggccaaactgctctccaggttggaattcaactcaaagaggagttc
gaaaaacttggcattcgtgttctcggtactccgatagacactatcatcaccacagaagac
cgtgagctcttcgcgagaagcatggaatcaatcgacgagaagtgcgccaaatccgcctct
gcttccacactcgaggaagcgatggaggttgtaaaggatatcggattccctgtcattgtc
cgtgctgcatacgctcttggtgggcttggaagcggtttcgctgaggatcctgaccaactg
cgggagctgtgcatgaaagccttcgctgcaagccctcaggttctcattgagaggagtatg
aaagggtggaaagagattgaatacgaagtggtccgcgatgctcgtgataactgtatcaca
gtgtgtaacatggagaattttgacccacttggtatccatactggtgattctattgtcgtt
gccccatcgcaaactctctccgatgaggactataatatgcttcggacaactgctgtcaat
gtcatccgccatttgggtgtggttggtgaatgcaacatacaatatgcgttgaacccattt
tcaagagaatattgcatcattgaggtcaatgctcgactatcaagatcatctgcactcgca
tccaaagcaacaggctatcccctcgccttcgtcgcagctaaacttggcctgggaatccca
ctgaacgagatctcgaactcagtcaccaaagtcacctgtgcttgcttcgagccttctctt
gattatgttgtcgttaagattccacgttgggatctcaagaagttcacccgtgtctccacc
cagctagggtcttccatgaagagtgttggagaggtcatgagcattggacggactttcgaa
gaggccatacagaaagccatccgttctgtcgacttccacaatgtcggattcaatgagacc
aacgcgcttatgtctattaaagctgagctccaaacaccgtccgatcagcgactgttcgcg
atcgccaacgctatgcattcggggtactcagtcgacgatatctgggaattgacaaaaatt
gacaagtggttcctccgtaaattgaaaggcctcagcgattttggcaaatttatgtctggc
tacaatgccaccaccgcacccgtttctcttattcgacaggcgaagcagctcggtttttcc
gaccgccaactgtcaaagttcttgagctctaatgagctggctatcaggcggttgagagtg
gaagcaggtattgttccggtagttaaacaaattgatacggttgccgctgaatttccagca
ttcacaaactatttatacctgacatacaacggttcagaacatgatgtggacttcaacgac
caaggtgttatggttcttggttctggcgtctacagaattggctcctctgtcgaatttgat
tggtgttctgtgcgaaccattcgaactctgcgagagcaagggtataagacagtcatggtc
aatatttcccgaaaacttctcaaggtcctctgctgctctgcctccaccagtttggttcct
ggttgctctggagacaattcgattgctatggcttctcctgtgttctctgcttcaacggca
ttaaagctcatcatgtctgttgtttggaaatgcctctgctatgcccgtccacgcttcaaa
catcctctattagcaagattcttcgatacccaggaagagttggaggcaactgctgagggg
atctctctctccttcgcctccggcctctttgatgtactaataactgtcaagtttaacccc
gagacggtgagcactgattatgatgaagcggataggttgtattttgagaacatcaacctg
gaaaccgtcctggatatctaccaacttgaatcttcaagcggcgttatcatatcaatgggc
ggacagacaccgaacaacattgcccttcctttataccggcttaatgtaaatatccttggc
acatctccagagatgattgatacggcggaaaatcgatacaaattttcgcgactccttgac
catattgatgtcgaccagcctgcttggaaagaacttacaagtatagaggaggctaccgca
ttctgtgcgaaggtcggatacccagtgttggtgcggccttcctacgtgctttcaggtgct
gccatgaacacagtttattcgttggacgatcttgcaaactatctcaaccaggctgctgag
gtctcacgcgagcaccccgtggtcattaccaaatatatagagagcgccaaggaaattgaa
atggacgcggttgcgaggaatggtgttttagtcggtcattttatttcagaacatgttgag
aatgctggtgtgcattccggtgatgctactttgattcttccgccccaggacctggacccg
gaaaccgtcagacggatcgaggaggcgactcgcaagatcggcaatgctctaaatgtcact
ggacctttcaacatccagttcattgccaaggataacgacattaaagtcatcgagtgcaat
gtgagggcatctagatccttcccattcgtttccaaggttatgggcgttgacttgatcgaa
atggcaacgatggcgatgatcggcaagcccttcactgagtatccgcctgtcaccattccc
aagaaatatgtcggagtcaaagttccccagttctcattctctcgcctttctggtgccgac
cctgtgctcggcgtggagatggcctccactggcgaagttgcatgcttcggtcgtgacaga
tacgaggcttatctcaaagctctgatttcaactggcttcaagctcccgaagaaaaacgtc
ctcttctccatcggcgctttcaaggagaaggttgagatgttgccatctatcagaaagctg
cacgcgcttggctacaatctttttgcgacagctggtactgcggactatctcaaggagcat
ggacttcccgtcaagtacctcgatgttcttgcgggagaggaggaggacctcaagtcggaa
tattctcttacgcaacatttggctaataatttgattgatctctacatcaatcttccctcc
agcaataggttccgacggcctgcaaactacatgagcaagggatatcgaacacgtcgaatg
gctgtcgactaccagactccgctggttaccaacgttaaaaacgcgaagctcctgattgag
gcgattgcacgccattactctatgaacgtgatgagcatcgattgccaaacaagctatcga
gcagttattctccccggcctcatcaacgtcgcagccttcgtgccgggactcgctaaccct
gattctccagatttccaggtggtgaccaaggcctccatcgctaatggtttcagcatggtc
cgcatcatgccagtgggcgttgatagcttcgttactgactcccaggcactcagaacggcc
cagcataattcgtctaagggctcgtactgcgatttcaatctatcggtcacggcaacatct
actaattcagagaaagttggcctaatcaccagcgaagtcggttcgttgtttatcccattc
aatcacctagcgggcaacatcaacaaggttgcaacggttacttcgcactttgcttcgtgg
ccgaccaacaaacctataatcaccgatgccaaagcaacagatttggcgtcaattttactc
cttgccagcctccacaatcgcaatatccacgtcatgagtgttactagcaaagaggacatc
ggcctaattgcacttagcaaggagaagggcctgaaagtgacatgcgatgtcgcgatctac
tctcttttcctgtctacggatgatttccccggttgtgcctgcctaccttcgaagaaagat
caagaagcgctctgggaacacttggattctatcgacatattttccattggcagtcttcca
taccaggttgccggcaaaaatgcctctcccgcagttggaatccaagacgcgcttcccctc
cttttcacagcggtttctgacaagcgattaacggttgaagatatcacatccagactccac
gataacccgaagagggttttcgaactccatgaccagccagatgcctccgtggagattgag
tttgacaggccatatgtgttccaaggccatgatgtctggtcgccatttgctggtactact
ctgaaggcatctgtccgacgagttacattccaaggcaagacgtcatgcttggatggtaaa
gtgataccagatgcaccgaggggcactgatatgtccgctcaccggttaacgccaccgcct
caaggatcgcccgctgttaaggatattctttccacatctccgcggccggaaagtgctctt
gggagacggttgtctttctcggccacaccactccagcgcccaacgagattcaaacctaat
gctcctgatggatatgctccatctgcttcgggagatgaattcgtgactgttgctccaatg
tacccatatccgtcccaggtttccccttcgttgcaacagctgctttcgcaatcgtctttt
aaacagaaacatatcctatctgtcggtcagttcactcgcactgatctacatctcctattc
acggttgcgcaggagatgcgactaggcgtccaacgccatggcattctcgacatcttgaaa
ggccgcgtccttacaacactattcttcgagccctctactcgtacatccgcctcgttcgat
gccgctatgcaacgactaggcggcagaaccattccagtttccaccgagcattcttctact
cagaaaggcgaaaccctccaggacactgtccgcaccttgggctgttacagcgatgcaatc
gtccttcggcacccagatgacagcagtgctgccaccgctgccaaattttccccggtcccc
atcatcaacgccggaaacggagccgtggaacaccccacccaagcatttctcgatctcttc
accatccgcgaggagctcggaaccgtcaatgacatcacaatcactttcactggtgatttg
aaatatggccgcaccgtgcactccctcgtaaagctgctccaattctacgaagtgcgcatc
cagctcgtgtctcccaaggcgcttgctatcccggaggaggtccgccaacagctcgtctta
tccggtcagcttattctcgagtcgacggagcttacaccggaaatcatcgcacggtcggat
gtgctttactgtacgcgcgtgcagaaagagcgcttcaaggactcgaacgaatatgagcag
ttgaagaacgtgttcgtcatcgataacacggtgcttaagcatgcgaagagccagatgatt
gttatgcaccccctgccgcgcaaccaggaggtatgtgaggaggttgattttgaccagcgt
gcggcttatttcagacagatgaaatatgggctttactgccgcatggcattactcgcattg
gtcatggcatcgtga

DBGET integrated database retrieval system