KEGG   Ajellomyces capsulatus: HCAG_08549Help
Entry
HCAG_08549        CDS       T02229                                 

Definition
similar to histone acetyltransferase subunit of the Elongator complex
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HCAG_08549
Transfer RNA biogenesis [BR:aje03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    HCAG_08549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 449 aa AA seqDB search
MATETLTALPATQLHKPQKPAKLPPENERYMRACSDIANALIQEFESQRDPTRPKKDVNL
NKLRGQISKKHQLSTQPPLTAIISAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHR
CPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVEQIKSL
GHSVDKVEYIIMGGTFMSLPEDYRDEFISQLHNALSGYQTKNVDEAVQAGEMSNIKCVGI
TIETRPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKAVAETFKLSKDAG
FKVISHMMPDLPNVGMERDLDQFREYFENPDFRTDGLKIYPTLVIRGTGLYELWRTGRYK
NYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTC
RDVRTREVGINEVKNKIRPQWRVGNVLGL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggagaccttgactgcgctgcccgccacgcaactgcacaaaccccagaaaccc
gcaaagcttccccccgagaatgaacggtatatgagagcctgttctgatattgcaaacgct
ctcatccaagaatttgagtcccagcgagaccccacgaggcctaagaaggatgtcaatctc
aataagctgcggggtcagatatcgaaaaagcaccagctgagcacccagcctccgctgaca
gccattatatctgctgtcccagagcattataagaaatacattctcccaaagctgattgcg
aaaccgataagaacatcgtctggaatcgccgtcgttgctgtaatgtgcaagccacaccgg
tgtccccatatcgcctatactggaaacatctgcgtctactgtcctggtggccccgactct
gatttcgaatattctacgcagtcgtataccggatacgaaccgacatccatgcgcgctatc
agagctcgatatgatcctttcgagcaagcgcggggtagagtcgaacaaatcaaatcactt
ggacacagcgtggataaagtggaatatattatcatggggggaactttcatgtcgcttccg
gaagattatcgagacgaattcatatcgcaactacacaatgcgctcagcggttatcagacc
aaaaatgtagacgaggcggtccaggccggggaaatgagtaatattaaatgtgtcggaatc
accatcgagacgcggccagattactgcctagatacgcacctaagcagcatgctccgatat
ggttgcacgcggctcgagatcggtgtgcagagtctctacgaagacgtcgcccgcgacacc
aacagaggccacaccgttaaagccgtagccgaaacattcaagctatccaaagacgccggc
ttcaaagtcatcagccacatgatgccagaccttcctaacgttggcatggagcgcgacctc
gaccagttccgtgaatatttcgagaacccggatttccgcactgatggcctgaagatctac
ccaactctcgtaatccgcggcacaggattatacgaactttggcgcacaggccgctacaaa
aactacaccccaaacgccctcatcgacattgtcgcccgtatcctcgccctcgttccaccc
tggactagaatctaccgcgtgcagcgtgacattcccatgcccctcgtcacctcgggtgtg
gaaaacggcaacctccgcgagctcgcactgagccgcatgaaggatttcggaaccacatgt
cgcgacgtgcgcacgcgcgaggtgggcatcaacgaagtgaagaacaaaatccgcccccaa
tggcgggtgggaaacgttcttggcctatga

DBGET integrated database retrieval system