KEGG   Ajellomyces capsulatus: HCAG_08703Help
Entry
HCAG_08703        CDS       T02229                                 

Definition
similar to YRK
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     HCAG_08703
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   HCAG_08703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 907 aa AA seqDB search
MDPQWQAYADATSGRPGQFNNGLGDHPPQTQKYPATSAGSGGQPQQHQHQQQNQAPMGYT
YEPYQTPGTVPKVPSGNSMSKTVSMTSSPTPLAGEFTDQDVTMEDADPYNRAKYAAKPSH
QRGSSQFLSSEESTAARRYSPMNVISPTQSYTASPNTSHNPYTFPPAGSSSSRPSPTRAN
TYSSPPQNYQSSPSATGGTSRQQPRLPNLQPAEMGPDQFYPHSTAPQTNPAFGQGVKPRG
QAPLHNILLPQQQHQRGPVPKFVKVKSTQELKPRINAQPAFRRANPEGGFISPLQALTTH
LPSTYRICNPSFKYESSRNPRRVLTKPSKGVKNDGYDNDDSDYILYVNDILGSQGTFGQV
VKCQNLKTQEVVAVKVVKNRTAYFNQSMMEVSVLDLINSKLDKNDDHHLLRLRDTFIHRQ
HLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLSLLNKARLIHCDLKPENIL
LKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVEL
FLGLPLFPGSSEYNQVSRITEMLGMPPNWMLEMGKQSGEFFEKTQDEFGRRTYRLKSMEQ
YSREHNTKEQPSKKYFQATTLPEIIRSYSMPRKNMKQAEIDREMNNRVAFIDFVRGLLNI
NPLERWSPQQAKLHPFITQQKYTQPFVPPMNLKSSALNKTIAPGVQQQQQAEAASKQRAA
QAQAQAQSAAQSYALQMNNHYTPSAHGQPPPVYNNMYNPHQQGAPPPYPSQPGAYGHQMP
IMQQQASHMPQQQFAASQSLYAQATTRAGRQRASTMDQQQGGIPQSIQRVASHLDPNAPI
RLQPSPAYYPPPADGYADTSTAAAGRRRGSRTGASGTGTHGRNNRDFIRTLEDGAMGDNF
MSQNQWH
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcagtggcaggcctatgctgatgccacttctggccgtccaggtcagtttaac
aatggtcttggggatcatcccccacaaacacagaaatacccggctacaagtgctggtagt
ggaggacaaccccagcagcatcagcaccagcagcaaaatcaagctcctatgggatacacg
tacgaaccatatcagactccaggaacagtgcccaaagtgccatctggtaattcgatgtcg
aagacggtatccatgacctcgtctccaacccctctcgctggcgagttcacagatcaggat
gtcaccatggaagacgccgatccttataaccgtgcgaaatacgctgccaaaccgagtcat
caacgtggctcgtcacagtttctatcgagtgaagaatccacggctgcgcgcagatattct
cccatgaacgttatttctcctacccagtcttacaccgctagtcccaatacctctcataac
ccatacacttttcctccagctgggtcatcgagctctcggccgtcacctacgagagccaat
acatattcctcgccgcctcagaactaccaatcttcgccatcagcaaccggtggcacctcc
cgtcagcaaccccgtttgcctaatctacagcctgcggaaatgggtccggaccagttctat
ccccattctacagctcctcagaccaacccggcctttggacagggcgtaaaacctagaggc
caagcaccactgcataatatcctactgccacagcaacaacaccagagggggccggtaccc
aagttcgtgaaggtcaaatcgacacaggagctgaaaccaaggataaatgcccaacctgca
tttcgacgtgctaatcccgaaggtggattcatcagtcccttgcaagccttgactacgcac
ttaccgtcgacttatcgaatatgtaatccatcgttcaagtatgagtcttcgaggaatcct
cgccgcgtgcttacaaaaccaagtaaaggcgtcaaaaacgatggttatgataacgatgac
agcgactatattctgtatgtcaacgatattctcggaagtcaagggacgttcggccaagtt
gtgaaatgtcaaaacctaaaaactcaggaggttgtggcggtcaaagttgtcaaaaataga
actgcctacttcaatcaaagtatgatggaggtgtcggttttggatctgatcaacagcaaa
cttgacaaaaacgatgatcatcacttgctccgcctaagggatacctttatccatcgacaa
catctttgtttagtctttgagttgctcagtgtgaatttgtacgaactgatcaaacagaat
caattccgcggcctcagcactacccttgtgcgtgtattcgcacaacaattactcaatggt
ctgtcgctcttaaataaggcccgcctaatacattgcgatctaaaacctgaaaatattctg
ctgaaaaacctcgaaagtccgataataaaaattatcgatttcggatcagcatgtgacgag
agacaaactgtttacacgtacatccagtccagattttaccgctcgcccgaagttctctta
ggtctaccctattcgtcggccattgacatgtggtctttgggttgtattgttgttgagctt
ttcctgggccttccattatttcctggttcttctgaatacaaccaagtgtcccggatcacc
gaaatgctaggaatgcctccgaattggatgcttgaaatgggcaaacaatcaggagaattt
tttgagaaaacgcaagatgagtttggccgtcgaacttacagacttaagagcatggaacag
tactctcgcgaacacaacacgaaagagcagccaagcaaaaagtatttccaggcaacgaca
ctaccggaaatcattcgtagttactcgatgccaagaaagaatatgaagcaggcggagatc
gatcgagaaatgaataaccgcgtcgcatttattgatttcgttcgaggtcttttgaacatc
aatcctcttgagagatggtcgccacaacaagcaaaactccaccctttcatcactcaacaa
aaatatacccaacctttcgtacccccaatgaacctcaagtcctcagcgttgaacaagacc
attgcgcctggtgtacagcaacaacaacaagcggaagctgccagtaagcaacgtgccgct
caggcgcaagctcaggctcaatccgcagcacagtcgtatgctctccagatgaataaccat
tacactccatccgcacatggacaacccccaccggtttacaacaacatgtacaatcctcat
caacaaggcgcaccaccaccatacccttcccagccgggtgcatacggccatcaaatgccg
ataatgcaacagcaagccagccatatgcctcagcagcaatttgcagcttcccaaagtctt
tatgctcaagctacaactcgagctgggcggcagcgagcatctactatggaccaacagcaa
ggcgggatacctcagtcgatccaacgagtcgcaagccaccttgatccgaacgcgccaatt
cgattacagccaagccctgcatactacccaccaccagctgatggttatgctgatacttct
actgccgctgctggacgccggagggggagccggactggagctagtgggactgggacccat
ggacgcaataatagggatttcatccggacacttgaagatggagcaatgggcgataacttt
atgagccagaatcagtggcattga

DBGET integrated database retrieval system