KEGG   Acidovorax sp. JS42: Ajs_0035Help
Entry
Ajs_0035          CDS       T00455                                 

Definition
sulfite dehydrogenase (cytochrome) subunit SorA apoprotein (EC:1.8.2.1)
Orthology
K05301  
sulfite dehydrogenase [EC:1.8.2.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
Sulfur metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ajs_0035
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.2  With a cytochrome as acceptor
    1.8.2.1  sulfite dehydrogenase
     Ajs_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(36284..37504)
Genome map
AA seq 406 aa AA seqDB search
MHTQAPASLPRRRLLAGSASALAAAGLASFHQGAAAQSAAPAAAKPLPGYAGWKNADAVI
VHSSTTIETRRGAFGTSVITPSDQLYVRNNLPTPPESIVADRDAWQVQVSGVKEPRRLSV
RELKAMGLETVTMVLQCSGNGRGFFPSKPSGTPWTVGAAGCVVWSGVPVRDVARALGGVA
DGMKYMTGTGGEVLPAGIDPKTVIVERSVPLEAMQDALLAWEMNGEPIPLAHGGPLRLIV
PGYTGVNNIKYIGQLAFTDKESEARIMSHGYRISPPGGKGDPSQPSVQQMSVKSWINGPL
PEDGELAPGRVQIHGVAFGGMHAVKGVEVSVDGGKTWQAARLVGPDMGRYAWRQFVLQAD
LPRGSHTLASRATDAQGNVQPEQREENQAGYNNSSWADHAVTVKVA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcacacccaagctcccgcctccctgccccgccgccgcctgctggcgggcagcgccagc
gcgctggccgccgccggcctggccagcttccaccagggcgccgcggcgcagtcggccgcg
ccggccgcggccaagccgctgcccggctacgccggctggaagaacgccgatgccgtcatc
gtgcacagcagcaccaccatcgagacgcgccgcggcgcctttggcaccagcgtcatcacg
ccctcggaccagctgtacgtgcgcaacaacctgcccacgccgcccgagtccatcgtcgct
gaccgcgacgcctggcaggtgcaggtgagcggggtaaaggagccgcgccgcctgtcggtg
cgcgagctcaaggccatggggctggagacggtgaccatggtgctgcagtgctcgggcaac
ggccggggcttcttccccagcaagcccagcggcacgccctggacggtgggcgccgccggc
tgcgtggtctggagcggcgtgcccgtgcgcgacgtggcgcgcgccctgggtggcgtggct
gacggcatgaagtacatgaccggcaccggcggcgaggtgctgcccgccggcatcgacccc
aagacggtgatcgtcgagcgttcggtgccgctggaggccatgcaggatgcgctgctggcc
tgggagatgaacggtgagcccataccgctggcgcacggcgggccgctgcgcctgatcgtg
ccgggctacaccggcgtgaacaacatcaagtacatcggccagctcgccttcaccgacaag
gagagcgaggcgcgcatcatgagccacggctaccgcatctcgccgccgggcggcaagggc
gaccccagccagccgtcggtgcagcagatgagcgtcaagtcctggatcaacggcccgctg
cccgaagatggcgagctggccccgggccgcgtgcagatccacggcgtggccttcggcggc
atgcacgccgtcaagggtgtggaggtgtccgtcgatggcggcaagacctggcaggccgcg
cgcctggtgggcccggacatgggccgctacgcctggcgccagttcgtgctgcaggccgac
ctgccgcgcggcagccacaccctggccagccgagccaccgatgctcagggcaacgtgcag
cccgagcagcgcgaggagaaccaagccggctacaacaacagcagctgggcggaccacgcg
gtgaccgtcaaggtggcctga

DBGET integrated database retrieval system