KEGG   Acidovorax sp. JS42: Ajs_0223Help
Entry
Ajs_0223          CDS       T00455                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00362  Benzoate degradation
ajs00620  Pyruvate metabolism
ajs00621  Dioxin degradation
ajs00622  Xylene degradation
ajs00650  Butanoate metabolism
ajs01100  Metabolic pathways
ajs01120  Microbial metabolism in diverse environments
ajs01220  Degradation of aromatic compounds
Module
ajs_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ajs_0223
   00650 Butanoate metabolism
    Ajs_0223
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ajs_0223
   00622 Xylene degradation
    Ajs_0223
   00621 Dioxin degradation
    Ajs_0223
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Ajs_0223
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Ajs_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 CofC DUF3689
Motif
Other DBs
NCBI-ProteinID: ABM40477
UniProt: A1W2K2
Position
239969..240877
Genome map
AA seq 302 aa AA seqDB search
MTQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLKRAREMGIKTTHEGVD
GLIPHMKADGVQIVFDATSAYVHAENSRKVNAQGALMIDLTPAAIGPFCVPPVNLKEHVG
KAEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSAGPGTRKNIDEFTRTTAG
AIEKVGGAQKGKAIIIINPADPPLIMRDTVHCLVEGEPDKEAITRSIHDMLAEVQKYVPG
YKLVNGPVFDGNRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAGKLTLQ
AA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaaatcaagtgcgccctgatcggccccggcaacatcggcaccgacctgctg
gccaagctgcagcgcagccccgtgctggaacccgtgtggatggtgggcatcgaccccgag
tccgacggcctcaagcgcgcccgtgaaatgggcatcaagaccacccacgaaggcgtggac
gggttgattccgcacatgaaggctgacggcgtgcagatcgtcttcgacgccaccagcgcc
tacgtgcatgccgaaaactcgcgcaaggtgaacgcgcagggcgcgctcatgatcgacctc
acgcctgcggccatcggcccgttctgcgtgccgcccgtcaacctgaaggagcacgtcggc
aaggccgagatgaacgtgaacatggtcacctgcggtggccaggccaccatccccatggtg
gcagcggtgagccgtgtgcagcccgtggcgtatggcgagatcgtggcgactgtgtccagc
cgctcggcaggccccggcacgcgcaagaacatcgacgagttcacccgcaccaccgccggt
gccatcgaaaaagtgggcggcgcccagaagggcaaggccatcatcatcatcaacccggcc
gatccaccgctgatcatgcgcgacaccgtgcactgcctggtcgagggcgagcccgacaag
gaagccatcaccaggagcatccacgacatgctggccgaagtgcaaaagtacgtgcccggc
tacaagctggtcaacggcccggtgtttgacggcaaccgcgtctcggtcttcctggaagtc
gaaggcctgggcgactacctgcccaagtacgccggcaacctggacatcatgaccgccgcc
gccgcccgcaccgccgaaatgtttgccgaagaaattctggccggcaagctcaccttgcaa
gctgcctga

DBGET integrated database retrieval system