KEGG   Acidovorax sp. JS42: Ajs_0247Help
Entry
Ajs_0247          CDS       T00455                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ajs_0247
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ajs_0247
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Ajs_0247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(262587..263507)
Genome map
AA seq 306 aa AA seqDB search
MTTLTLIGAPTDVGASVLGASMGPDALRIAGIARAMQARGFDVRDQGNLAGPGNPQAEPA
SGFRHLAEVAAWNRAVYEATHAALQAGQLPLLMGGDHCLAIGSISAVAQHCRARGRRLKV
LWFDAHADANTPESSPSGNLHGMPVACLLGHGPAQLTRLAGPEDPPALQPGQITLIGVRS
VDATEKRFVNEHGIEVYDMRTIDELGMRAVMQAALADVDQDTHLHVSFDMDCLDPSVAPG
VGTGVRGGPTYRETQLCMEMLADCGALGSADLVELNPALDVRNQTAELAVDLLESLFGKS
TLMRPQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctgaccctgatcggcgcccccaccgacgtgggcgccagcgtgctgggcgcc
agcatgggccccgacgcgctgcgcatcgcgggcatcgcgcgggccatgcaggcacgcggc
ttcgacgtgcgcgaccagggcaacctggccggccccggcaatccgcaggccgagcccgcc
agcggctttcgccatctggccgaggtcgcggcctggaaccgggcggtgtacgaagccacg
cacgctgcgcttcaggcgggccagctgccgctgctcatgggcggcgaccactgcctggcc
atcggctccatcagcgccgtggcgcagcactgccgcgcgcgcgggcggcggctgaaggtg
ctgtggttcgacgcgcacgcggacgccaacacccccgagtcctcccccagcggcaacctg
cacggcatgcctgtggcgtgcctgctgggccacggcccggcacagctcacgcgcctggcc
ggccccgaggacccaccggcgctgcagcccgggcagatcacgctgatcggcgtgcgcagc
gtggacgccaccgagaagcgcttcgtcaacgagcacggcatcgaggtgtacgacatgcgc
accatcgacgagctgggcatgcgcgcggtgatgcaggccgcgctggccgacgtggaccag
gacacgcacctgcacgtgagcttcgacatggattgcctggacccgtcggtggccccgggc
gtgggcaccggcgtgcgcggcggcccgacctaccgcgagacccagctgtgcatggagatg
ctggccgactgcggcgcgctcggctcggcggacctggtggagctgaaccctgcgctggac
gtgcgcaaccagacggccgagctggccgtggacctgctggagagcctgttcggcaagtcc
acgctgatgcgcccgcaatga

DBGET integrated database retrieval system