KEGG   Acidovorax sp. JS42: Ajs_0338Help
Entry
Ajs_0338          CDS       T00455                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ajs  Acidovorax sp. JS42
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_0338
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ajs_0338
   00630 Glyoxylate and dicarboxylate metabolism
    Ajs_0338
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ajs_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(346878..349079)
Genome map
AA seq 733 aa AA seqDB search
MTARTHVHGLQVANELHAFINEQVLPGTGVEPAAFWKGFDALVADLAPKNAALLAERDRL
QKELDTWHKANPGPIQDMAGYRAFLSQIGYLVEPPKGAQATTTNVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPVRGAKVIAFARDFLDQAA
PLASGSHKDATAYKVEGGTLAVTLQGGATTGLKNAAQFVGYQGNAAEPSSVLLVNNGLHI
DIRVDRNTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVLGYSNWLGILKGTL
TDTFDKGGKQVTRGLNPDREYTGADGKPVKLHGRSLMFVRNVGHLMTNPAILWGGEGKEI
PEGILDAMVTTAIAIHDLKGGAGGIRNSRTGSVYIVKPKMHGPAEVAFANELFGRVEQVL
GLPANTVKLGIMDEERRTSVNLKACIAAAPARVAFINTGFLDRTGDEIHTAMQAGPMIRK
GDMKSSAWIQAYERNNVLVGLSMGLSGRAQIGKGMWAAPDLMKAMLEQKIAHPKAGANTA
WVPNPTGATLHALHYHQVNVAAVQAELLKVDADAERDNLLTGLLTVPVSSNPNWSETEKQ
QELDNNIQGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHVANWLLHGVVTE
GQVRATFERMAAKVDQQNSGDPLYQRMHGRFAESMAYQAACDLVFKGVEQPSGYTEPLLH
AWRQKVKAAQKKA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtacccacgtccacggcctgcaggtggccaacgaactgcacgccttcatc
aacgagcaggtgctgccgggcaccggcgtcgagccggcagccttctggaagggcttcgat
gccctcgtggccgacctggcgcccaagaacgcggccctgctggccgaacgcgaccgcctg
caaaaggaactggacacctggcacaaggccaacccgggccccatccaggacatggcaggc
taccgcgccttcctgagccagatcggctacctggtcgagccccccaagggcgcgcaggcc
accaccaccaacgtggatgccgagctggccatccaggccggcccacagctggtggtgccc
atcctgaacgcacgctacgccctgaacgccgccaacgcgcgctggggctcgctgtatgac
gcgctgtacggcaccgacgtgatcggcgaagaaggcggcgcggagaagggcaagggctac
aaccccgtgcgtggcgccaaggtcatcgcattcgcacgcgactttctggaccaggcggcc
ccgctggccagcggctcgcacaaggacgccacggcctacaaggtcgagggcggcacgctg
gccgtcacgctccagggcggtgccaccaccggcctgaagaacgcggcccagttcgtgggc
taccagggcaatgcggccgagccatcgtccgtgctgctggtgaacaacggcctgcacatc
gacatccgtgtcgaccgcaacacccccatcggcaagggcgacgccgccggcgtggccgac
gtggtggtggaagctgcgctgtccaccatcctggacctggaagactccgtggccgccgtg
gacgccgaggacaaggtgctgggctacagcaactggctgggcatcctcaagggcacgctg
accgacaccttcgacaagggcggcaagcaggtcacgcgcggcctgaaccccgaccgcgaa
tacaccggcgccgacggcaagcccgtgaagctgcacggccgctcgctgatgttcgtgcgc
aacgtggggcatctgatgaccaaccccgccatcctgtggggtggcgagggcaaggaaatt
cccgagggcatcctggacgccatggtcaccacggccatcgccatccatgacctcaagggt
ggcgcgggtggcatccgcaacagccgcacgggcagcgtctacatcgtcaagcccaaaatg
cacggccctgccgaagtggcgtttgccaacgagctgttcggccgcgtggagcaggtgctg
ggcctgcccgccaacaccgtgaagctgggcatcatggacgaagagcgccgcaccagcgtg
aacctgaaggcctgcattgccgccgctccggcgcgcgtggccttcatcaacaccggcttc
ctggaccgcaccggcgacgagatacacaccgccatgcaggccggccccatgatccgcaag
ggcgacatgaagagcagcgcctggatccaggcctacgagcgcaacaacgtgctggtgggc
ctgtccatgggcctgtccggccgcgcgcagatcggcaagggcatgtgggccgcacccgac
ctgatgaaggccatgctggagcagaaaattgcccatcccaaggccggcgccaacactgcc
tgggtgcccaaccccacgggcgccacgctgcacgcgctgcactaccaccaggtcaacgtg
gccgccgtgcaggccgagctgctcaaggtggacgccgacgccgagcgcgacaacctgctg
accggcctgctcaccgtgcccgtgagcagcaacccgaactggagcgagaccgaaaagcag
caggagctggacaacaacatccagggcatcctgggctacgtggtgcgctggatcgaccag
ggcgtgggctgctccaaagtgccggacatcaacgacatcggcttgatggaagaccgcgcc
acgctgcgcatctccagccagcacgtggccaactggctgctgcacggcgtggtgaccgaa
gggcaggtacgcgccacgttcgagcgcatggccgccaaggtggaccagcaaaacagcggc
gacccgctgtaccagcgcatgcacggccgctttgccgagtccatggcctaccaggccgcc
tgcgacctggtgttcaagggcgtagagcagcccagcggctacaccgagccgctgctgcac
gcctggcgccagaaggtgaaggccgcgcagaagaaggcttga

DBGET integrated database retrieval system