KEGG   Acidovorax sp. JS42: Ajs_0338Help
Entry
Ajs_0338          CDS       T00455                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ajs  Acidovorax sp. JS42
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_0338
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ajs_0338
   00630 Glyoxylate and dicarboxylate metabolism
    Ajs_0338
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ajs_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(346878..349079)
Genome map
AA seq 733 aa AA seqDB search
MTARTHVHGLQVANELHAFINEQVLPGTGVEPAAFWKGFDALVADLAPKNAALLAERDRL
QKELDTWHKANPGPIQDMAGYRAFLSQIGYLVEPPKGAQATTTNVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPVRGAKVIAFARDFLDQAA
PLASGSHKDATAYKVEGGTLAVTLQGGATTGLKNAAQFVGYQGNAAEPSSVLLVNNGLHI
DIRVDRNTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVLGYSNWLGILKGTL
TDTFDKGGKQVTRGLNPDREYTGADGKPVKLHGRSLMFVRNVGHLMTNPAILWGGEGKEI
PEGILDAMVTTAIAIHDLKGGAGGIRNSRTGSVYIVKPKMHGPAEVAFANELFGRVEQVL
GLPANTVKLGIMDEERRTSVNLKACIAAAPARVAFINTGFLDRTGDEIHTAMQAGPMIRK
GDMKSSAWIQAYERNNVLVGLSMGLSGRAQIGKGMWAAPDLMKAMLEQKIAHPKAGANTA
WVPNPTGATLHALHYHQVNVAAVQAELLKVDADAERDNLLTGLLTVPVSSNPNWSETEKQ
QELDNNIQGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHVANWLLHGVVTE
GQVRATFERMAAKVDQQNSGDPLYQRMHGRFAESMAYQAACDLVFKGVEQPSGYTEPLLH
AWRQKVKAAQKKA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtacccacgtccacggcctgcaggtggccaacgaactgcacgccttcatc
aacgagcaggtgctgccgggcaccggcgtcgagccggcagccttctggaagggcttcgat
gccctcgtggccgacctggcgcccaagaacgcggccctgctggccgaacgcgaccgcctg
caaaaggaactggacacctggcacaaggccaacccgggccccatccaggacatggcaggc
taccgcgccttcctgagccagatcggctacctggtcgagccccccaagggcgcgcaggcc
accaccaccaacgtggatgccgagctggccatccaggccggcccacagctggtggtgccc
atcctgaacgcacgctacgccctgaacgccgccaacgcgcgctggggctcgctgtatgac
gcgctgtacggcaccgacgtgatcggcgaagaaggcggcgcggagaagggcaagggctac
aaccccgtgcgtggcgccaaggtcatcgcattcgcacgcgactttctggaccaggcggcc
ccgctggccagcggctcgcacaaggacgccacggcctacaaggtcgagggcggcacgctg
gccgtcacgctccagggcggtgccaccaccggcctgaagaacgcggcccagttcgtgggc
taccagggcaatgcggccgagccatcgtccgtgctgctggtgaacaacggcctgcacatc
gacatccgtgtcgaccgcaacacccccatcggcaagggcgacgccgccggcgtggccgac
gtggtggtggaagctgcgctgtccaccatcctggacctggaagactccgtggccgccgtg
gacgccgaggacaaggtgctgggctacagcaactggctgggcatcctcaagggcacgctg
accgacaccttcgacaagggcggcaagcaggtcacgcgcggcctgaaccccgaccgcgaa
tacaccggcgccgacggcaagcccgtgaagctgcacggccgctcgctgatgttcgtgcgc
aacgtggggcatctgatgaccaaccccgccatcctgtggggtggcgagggcaaggaaatt
cccgagggcatcctggacgccatggtcaccacggccatcgccatccatgacctcaagggt
ggcgcgggtggcatccgcaacagccgcacgggcagcgtctacatcgtcaagcccaaaatg
cacggccctgccgaagtggcgtttgccaacgagctgttcggccgcgtggagcaggtgctg
ggcctgcccgccaacaccgtgaagctgggcatcatggacgaagagcgccgcaccagcgtg
aacctgaaggcctgcattgccgccgctccggcgcgcgtggccttcatcaacaccggcttc
ctggaccgcaccggcgacgagatacacaccgccatgcaggccggccccatgatccgcaag
ggcgacatgaagagcagcgcctggatccaggcctacgagcgcaacaacgtgctggtgggc
ctgtccatgggcctgtccggccgcgcgcagatcggcaagggcatgtgggccgcacccgac
ctgatgaaggccatgctggagcagaaaattgcccatcccaaggccggcgccaacactgcc
tgggtgcccaaccccacgggcgccacgctgcacgcgctgcactaccaccaggtcaacgtg
gccgccgtgcaggccgagctgctcaaggtggacgccgacgccgagcgcgacaacctgctg
accggcctgctcaccgtgcccgtgagcagcaacccgaactggagcgagaccgaaaagcag
caggagctggacaacaacatccagggcatcctgggctacgtggtgcgctggatcgaccag
ggcgtgggctgctccaaagtgccggacatcaacgacatcggcttgatggaagaccgcgcc
acgctgcgcatctccagccagcacgtggccaactggctgctgcacggcgtggtgaccgaa
gggcaggtacgcgccacgttcgagcgcatggccgccaaggtggaccagcaaaacagcggc
gacccgctgtaccagcgcatgcacggccgctttgccgagtccatggcctaccaggccgcc
tgcgacctggtgttcaagggcgtagagcagcccagcggctacaccgagccgctgctgcac
gcctggcgccagaaggtgaaggccgcgcagaagaaggcttga

DBGET integrated database retrieval system