KEGG   Acidovorax sp. JS42: Ajs_0382Help
Entry
Ajs_0382          CDS       T00455                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ajs_0382
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ajs_0382
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ajs_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(394655..396151)
Genome map
AA seq 498 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDERGHIVAQAQLELPQIYPQPGWVEHDPLEIWRTQIATARD
ALAKAGIAANAVRAVGITNQRETTVLWNRKTGQPVHHAIVWQDRRAEPACAQLREQGHAA
TIQAKTGLLIDAYFSGTKLQWLLDHVPGARDAAEAGELAFGTVDSWLIWQLTGGKRHVTD
VSNASRTMLFNVHTNQWDDELLQLLRIPRALMPEVLPSASDFGATDAALLGGPIAIGGVA
GDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSRFQKSENGLLTTSAAQAGQSPEYAME
GSVFVGGAVVQWLRDGLRAISASSEVQALAESVPDSGGVMMVPAFTGLGAPYWKPDARGT
ITGLTRGTTIAHIARAALESIAYQSAALLAAMSRDAVAAGGAPVSELRVDGGACVNDLLM
QFQADLLGIPVVRPAVVETTALGAAYLAGLASGVYASTDELSALWQAERRFTPTLPRSQA
EALMARWEHAVAQAVLPG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgcactcgaccaaggcacctccagctcccgcagcatcgtgttcgat
gaacgcggccacatcgtggcgcaggcgcagctcgagttaccccagatctacccccagccc
ggctgggtggagcacgacccgctggaaatctggcgcacccagatcgccaccgcgcgcgac
gcgctggccaaagcgggcattgccgccaatgctgtgcgggcggtaggcatcaccaaccag
cgcgaaaccacggtgctgtggaaccgcaagaccggtcagcccgtgcaccacgccatcgtg
tggcaagaccgccgcgccgaacccgcctgcgcccaactgcgtgaacagggccacgccgcc
accatccaggccaagacgggcctgctgatcgacgcctacttctccggcaccaaactgcag
tggctgctggaccacgtgcccggcgcgcgcgacgcggccgaggccggcgagctggccttc
ggcaccgtggacagctggctcatctggcagctcaccggcggcaagcgccatgtcaccgac
gtgagcaacgccagccgcaccatgctgttcaacgtgcacaccaaccagtgggacgatgag
ctgctgcagcttttgcgcatcccgcgcgcgctgatgcccgaggtgctgccatcggccagc
gacttcggcgccaccgacgcggcgctgctgggcggcccgattgccattggcggcgtggca
ggcgaccagcaaagcgcgctcttcggccaggcgtgcttcaccgccggcatggccaagaac
acctacggcacgggctgcttcatgctcatgcacaccggcagccgctttcagaaaagcgag
aacggcctgctcaccaccagcgcagcgcaggccggccaatcgcccgagtacgccatggaa
ggcagcgtgttcgtgggcggcgccgtggtgcagtggctgcgcgacgggctgcgcgccatc
tcggccagctccgaggtgcaggcgctggccgaaagcgtgcccgactcgggcggcgtgatg
atggtgcctgccttcaccggcctgggcgcgccctactggaagcccgacgcgcgcggcacc
attaccggcctcacgcgcggcaccaccatcgcgcacatcgcgcgcgccgcgctcgaatcc
attgcctaccagagcgccgcgctgctggccgccatgagccgcgacgccgtggccgcaggc
ggcgccccggtgagcgagctgcgcgtggacggcggcgcctgcgtgaacgacctgctgatg
cagttccaggccgacctgctgggcatccccgtggtgcgccccgccgtggtggagaccacc
gccctgggcgccgcctacctggcgggcctggcgagcggcgtgtatgccagcaccgacgag
ctgtctgccctgtggcaggccgagcggcgcttcacccccaccctgccgcgcagccaggcc
gaggcgttgatggcgcgttgggagcacgccgtcgcgcaggccgtgctacccggttga

DBGET integrated database retrieval system