KEGG   Acidovorax sp. JS42: Ajs_0500Help
Entry
Ajs_0500          CDS       T00455                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_0500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_0500
   00052 Galactose metabolism
    Ajs_0500
   00500 Starch and sucrose metabolism
    Ajs_0500
   00520 Amino sugar and nucleotide sugar metabolism
    Ajs_0500
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ajs_0500
   00524 Butirosin and neomycin biosynthesis
    Ajs_0500
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ajs_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
519808..520818
Genome map
AA seq 336 aa AA seqDB search
MMGPMPQQSPTSQSPGLHAGVDIGGTKVAVCLADPANGSGPPVLLTRVAEPTAKTGVPDA
LAQQVLRLLDAACTQQGITRSDLAGVGVASCGPFVRSAGMVEVVNPNICGGLAGAPRGLG
NDWTRVPLQAPLAQALGADRVHVANDAVAALQAERLWGALRGEDDCAYVTWSTGIGVGLC
VDGCVLRGKNGNAGHAGHSYVGDPDAGSDVALCGCGNQGDVESLVAGSALPRRLGREAPA
LMAAADAGDEAALAEVQALCVLMGRLLYNLVATLDLRRISLGGAVFLHHQALLLPLLRAQ
LARYFPALTAGVELVPAGLGGQVGDYAALALLQQPG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgggccccatgccgcagcaatctcctacctcccagtcgccgggcctgcatgccggc
gtggacattggcggcaccaaagtggccgtgtgcctggcggaccctgccaacggcagcggg
ccgccggtgttgctcacgcgcgtggcggagcccaccgccaagaccggtgtgccggatgcg
ctggcccagcaggtgcttcggctgctggatgccgcctgcacgcagcagggaatcacgcgt
tcggatctggcgggtgtgggcgtggcgtcctgcgggccgttcgtgcggagtgcgggcatg
gtcgaagtggtcaaccccaacatctgcggagggctcgccggtgcgccgcgcggcctgggc
aacgactggacccgggtgccgctgcaggcacccttggcgcaggcgctgggcgcagaccgc
gtgcatgttgccaacgatgccgtggccgcgctgcaggccgagcggctgtggggagcgctg
cggggggaggacgattgcgcctacgtgacctggagtaccggcatcggcgtcggcctgtgc
gtggacggctgcgtgctgcgcggcaagaacggcaacgcgggccatgccggccacagctac
gtgggcgaccccgacgcgggcagcgacgtggcgctgtgcggctgcggcaaccagggcgat
gtggagtcgctcgtcgcgggcagtgcgctgccgcgccgactgggccgggaggcgcccgcg
ctgatggcggcggcggacgcgggtgacgaggccgcgctggccgaagtgcaggcgctgtgc
gtgctgatgggacggctgctgtacaacctggtggccacgttggacctgcggcgcatcagc
ctgggcggtgccgtgttcctgcaccaccaggcgctgctgctgccgctgctgcgtgcgcag
ctggcgcgctacttccccgcgctcaccgccggggtagagctggtgcctgcggggctgggc
ggccaggtgggcgactacgcggcgttggctctgctgcagcagccgggctga

DBGET integrated database retrieval system