KEGG   Acidovorax sp. JS42: Ajs_0844Help
Entry
Ajs_0844          CDS       T00455                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ajs  Acidovorax sp. JS42
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ajs01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ajs00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
890147..891289
Genome map
AA seq 380 aa AA seqDB search
MVSSVLRDARRIVVKVGSSLVTNEGRGLDEVAIGEWCRQLAALVRGQGGEPREVIMVSSG
AIAEGMKRLGWSSRPGEIHELQAAAAVGQMGLAQMYETKLREQSMGSAQVLLTHADLADR
ERYLNARSTLLTLLRLGVVPVINENDTVVTDEIKFGDNDTLGALVANLVEADALVILTDQ
KGLYTADPRRDPQAQFVHEAQAGDAALEAMAGGAGSSIGKGGMITKILAAKRAAGSGAST
VIAWGREPDVLLRLARGESIGTLLVAQTQKNQARKQWMVDHLQLRGSVTVDAGAAAKLRE
DGKSLLPIGMVAVEGDFVRGDVIAVRDPGGTEIARGLANYASAEARLLCRKPSAEFERLL
GYAAEPEMVHRDNMVVLGAR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccagtgtattgcgcgacgcgcgtcgcatcgtggtcaaggtagggtccagtctc
gtcacgaatgagggacgggggctggacgaggtggccattggggagtggtgccgccaactg
gcagcgctggtgcgggggcaggggggcgagccgcgcgaggtcatcatggtctccagcgga
gcgatcgccgaaggcatgaagcgcctgggctggagcagccgccccggcgagatccacgaa
ctgcaggccgctgccgccgtgggacagatggggctggcgcagatgtacgagaccaagctg
cgcgagcaatccatgggcagtgcgcaggtgctgctgacccatgccgacttggcggaccgc
gagcgctacctgaatgcccgctccaccctgctgacgctgctgcgcctgggcgtggtgccg
gtgatcaatgagaacgacaccgtagtcaccgatgagatcaagtttggtgacaacgatact
ctgggggctctcgtcgccaacctcgtcgaagccgacgcgctggtgatcctgaccgaccag
aaggggctgtacaccgccgatccgcggcgcgacccgcaggcgcagttcgtccacgaggca
caggctggcgatgcggcgctggaggcgatggccggcggcgcgggctccagcatcggcaag
ggcgggatgatcaccaagatcctcgcggccaaacgtgcggcgggctcgggtgcttccacc
gtcatcgcatgggggcgggagccggacgtgctgctgcggctggcccggggcgaatcgatc
ggcacgttgctcgtggcgcagacgcagaagaaccaggcgcgcaagcagtggatggtggac
cacctgcaactgcgcggctccgtgacggtggatgccggcgcggcggccaagctgcgcgaa
gacggcaagagcctgctgccgatcggcatggtggcggtggagggcgacttcgtgcgcggc
gatgtgatcgcggtgcgcgaccccggcggcacagagatcgcccgcggtctcgccaactat
gcgagcgccgaggcgcgcctgctgtgccgcaagccttccgcagagtttgagcgcctgctg
gggtacgcggccgaaccggagatggttcaccgcgacaacatggtggtgctcggcgcgcga
tga

DBGET integrated database retrieval system