KEGG   Acidovorax sp. JS42: Ajs_0879Help
Entry
Ajs_0879          CDS       T00455                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ajs  Acidovorax sp. JS42
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ajs_0879
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ajs_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929645..930370
Genome map
AA seq 241 aa AA seqDB search
MSSEPPAPLSGAAPDEGTPVSVKIRERLNAARRRFHANDNIAEFIQPGELERLLDEVEAK
MQGVLDSMVIDTAGDHNTQATARRVAKMYLNEVFKGRYVQPPAITEFPNAEHLNELMIVG
PVTVRSACSHHFCPVIGKIWIGVLPNEHTNVIGLSKYARLVDWVMGRPQIQEEAVVQLAD
LIMEKTQPDGLAIVMEASHFCMSWRGVREMDSKMINSVMRGVFLTNPTLRREFLALIPRR
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaacccccagcacccctgagcggcgccgcgcccgacgagggcacgcccgtc
tccgtcaagattcgcgaacggctgaacgcggcgcgccggcgcttccatgccaacgacaac
attgcggagttcatccagcccggcgagctggagcgcctgctggacgaggtcgaggccaag
atgcagggcgtcctcgacagcatggtcatcgacacagcgggcgaccacaacacgcaggcc
acggcgcgccgggtggccaagatgtacctcaacgaggtcttcaagggccgctacgtgcag
ccgccggcgatcaccgagtttcccaacgccgagcacttgaacgagctgatgatcgtcggc
cccgtcaccgtgcgcagcgcctgcagccaccacttctgcccggtgatcggcaagatctgg
atcggcgtgctgcccaacgagcacaccaacgtgatcggcctgtccaagtacgcgcgcctc
gtggactgggtcatggggcgtccccagatccaggaggaggccgtggtgcaactggccgac
ctcatcatggaaaagacccagcccgacgggctggccatcgtcatggaggccagccacttc
tgcatgtcctggcgcggtgtgcgcgagatggacagcaagatgatcaactcggtgatgcgc
ggggtgttcctcaccaaccccacgctgcgccgcgaattcctggccctcattccccgaagg
agctga

DBGET integrated database retrieval system