KEGG   Acidovorax sp. JS42: Ajs_0896Help
Entry
Ajs_0896          CDS       T00455                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00900  Terpenoid backbone biosynthesis
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ajs_0896
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ajs_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABM41138
UniProt: A1W4G3
Position
complement(944987..945838)
Genome map
AA seq 283 aa AA seqDB search
MQALYDVPAPAKLNLFLHVTGRRPDGYHLLQSVFMLIDWCDVLHFEVGGNGAVTREDLTS
ALPADDLVVRAARALQKATGCPQGVHIGVSKHIPAQAGLGGGSSDAASTLLALNRLWKLK
LSRQQLHSIALTLGADVPFFLCGASAWVEGIGDIIRPLELEHQLPPAAFAVVKPEAGLDT
RMIFSHPSLKRDSSCATISGFAATHYQFGSNDLQPVAQALCPEITQAINWLESKGLQGRM
TGSGSAVFAQITHAVDLHDAPAAWHVKVCENLKSHPLADWVFG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctgtacgacgtgccggcgccggccaaactgaacctgtttctgcatgtcacg
ggtcgcaggcccgatggctatcacctgctgcagtcggtcttcatgttgatcgattggtgc
gatgttctgcatttcgaggtgggcggcaatggggccgtcacacgtgaagaccttaccagc
gccctgcctgcggacgatctggtcgtgcgcgccgcacgtgcgctgcaaaaggccaccggt
tgcccgcaaggggtacatatcggcgtctctaaacacatccccgcacaagccggcttgggt
ggcggatcttcggacgcggccagcacactgctggcgctcaaccgcttgtggaagttgaaa
ctgtctcggcagcagttgcactcgatcgccctgacgctgggcgccgatgttccgtttttt
ttgtgcggcgcaagcgcctgggtcgagggaattggtgacataattcgccctcttgagttg
gagcaccaacttccgcctgcggctttcgcggtggtcaagcccgaagcggggctggatacg
agaatgattttttcgcatccctcccttaaacgtgattcgagttgtgctacaatttcaggc
tttgctgcaacacactaccaatttggaagcaatgacctgcagccagtcgcacaggccttg
tgccctgagattacgcaagccatcaattggcttgaatcaaaagggttgcaaggacgcatg
acaggctctggaagtgcggtgtttgcacaaatcacacacgctgtcgatctgcacgatgca
cccgctgcttggcatgtcaaagtgtgtgaaaatctaaagtctcatccgctagcggattgg
gtttttggatga

DBGET integrated database retrieval system