KEGG   Acidovorax sp. JS42: Ajs_0955Help
Entry
Ajs_0955          CDS       T00455                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_0955 (tpiA)
   01230 Biosynthesis of amino acids
    Ajs_0955 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_0955 (tpiA)
   00051 Fructose and mannose metabolism
    Ajs_0955 (tpiA)
   00562 Inositol phosphate metabolism
    Ajs_0955 (tpiA)
Enzymes [BR:ajs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ajs_0955 (tpiA)
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ajs_0955 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ajs_0955 (tpiA)
  Exosomal proteins of melanoma cells
   Ajs_0955 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
997429..998181
Genome map
AA seq 250 aa AA seqDB search
MTQKKKLIAGNWKMNGSLQANAALLQALRDGLGAPGCGVAVAVPAPYLAQVQALVAGSEI
ALAAQDVSQHERGAFTGEVSVGMLRDFDARYALVGHSERRQYHGETDAVVAAKAQRALSG
GVTPIVCVGETLAEREAGQTETVVKRQLAAVIHAVGHCVSEIVVAYEPVWAIGTGRTATP
EQAQQVHAVLRAQLAAATESADRVLILYGGSLNAANAAELLAQPDIDGGLVGGASLKAAD
FLKIIAAAHS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaaaagaaactcattgccggcaactggaagatgaacggcagcctgcaggcg
aatgcggcgctgctgcaggcgttgcgtgatggcttgggcgcgcccggttgcggcgtggcg
gtggccgtgccggcgccctacctggcgcaggtgcaggccttggtcgcgggcagcgaaatc
gctctggccgcccaggatgtgtcgcagcatgaaaggggcgcgttcaccggcgaggtctcc
gtgggaatgttgcgcgactttgatgcacgctacgcgcttgtggggcactccgagcgtcgc
caataccatggcgaaaccgatgccgtggtcgcggccaaggcccagcgggcgctctcgggc
ggcgtcacgccgatcgtatgcgtgggggaaaccctggcggagcgcgaggcgggccagacc
gagaccgtcgtcaagcgccaactggcggctgtgatccatgccgtggggcactgcgtgagc
gagatcgtggtggcctacgagcctgtctgggccatcggcactggccgcacggcaacacca
gagcaggcgcagcaggtgcatgcggtgctgcgcgctcagctcgccgccgcgaccgaaagc
gcggatcgcgtgctcatcctgtatggcggcagcttgaatgctgccaacgcagccgaactg
ctggcgcagccggatatcgatgggggcctggtgggcggtgcgtcgctcaaggccgcggat
ttcttgaaaattatcgctgcagcgcatagctga

DBGET integrated database retrieval system