KEGG   Acidovorax sp. JS42: Ajs_0955Help
Entry
Ajs_0955          CDS       T00455                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00010  Glycolysis / Gluconeogenesis
ajs00051  Fructose and mannose metabolism
ajs00562  Inositol phosphate metabolism
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01200  Carbon metabolism
ajs01230  Biosynthesis of amino acids
Module
ajs_M00002  Glycolysis, core module involving three-carbon compounds
ajs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_0955
   00051 Fructose and mannose metabolism
    Ajs_0955
   00562 Inositol phosphate metabolism
    Ajs_0955
Enzymes [BR:ajs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ajs_0955
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ajs_0955
  Exosomal proteins of bladder cancer cells
   Ajs_0955
  Exosomal proteins of melanoma cells
   Ajs_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM41195
UniProt: A1W4M0
Position
997429..998181
Genome map
AA seq 250 aa AA seqDB search
MTQKKKLIAGNWKMNGSLQANAALLQALRDGLGAPGCGVAVAVPAPYLAQVQALVAGSEI
ALAAQDVSQHERGAFTGEVSVGMLRDFDARYALVGHSERRQYHGETDAVVAAKAQRALSG
GVTPIVCVGETLAEREAGQTETVVKRQLAAVIHAVGHCVSEIVVAYEPVWAIGTGRTATP
EQAQQVHAVLRAQLAAATESADRVLILYGGSLNAANAAELLAQPDIDGGLVGGASLKAAD
FLKIIAAAHS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaaaagaaactcattgccggcaactggaagatgaacggcagcctgcaggcg
aatgcggcgctgctgcaggcgttgcgtgatggcttgggcgcgcccggttgcggcgtggcg
gtggccgtgccggcgccctacctggcgcaggtgcaggccttggtcgcgggcagcgaaatc
gctctggccgcccaggatgtgtcgcagcatgaaaggggcgcgttcaccggcgaggtctcc
gtgggaatgttgcgcgactttgatgcacgctacgcgcttgtggggcactccgagcgtcgc
caataccatggcgaaaccgatgccgtggtcgcggccaaggcccagcgggcgctctcgggc
ggcgtcacgccgatcgtatgcgtgggggaaaccctggcggagcgcgaggcgggccagacc
gagaccgtcgtcaagcgccaactggcggctgtgatccatgccgtggggcactgcgtgagc
gagatcgtggtggcctacgagcctgtctgggccatcggcactggccgcacggcaacacca
gagcaggcgcagcaggtgcatgcggtgctgcgcgctcagctcgccgccgcgaccgaaagc
gcggatcgcgtgctcatcctgtatggcggcagcttgaatgctgccaacgcagccgaactg
ctggcgcagccggatatcgatgggggcctggtgggcggtgcgtcgctcaaggccgcggat
ttcttgaaaattatcgctgcagcgcatagctga

DBGET integrated database retrieval system