KEGG   Acidovorax sp. JS42: Ajs_1067Help
Entry
Ajs_1067          CDS       T00455                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_1067
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_1067
   00620 Pyruvate metabolism
    Ajs_1067
   00640 Propanoate metabolism
    Ajs_1067
  Energy metabolism
   00680 Methane metabolism
    Ajs_1067
Enzymes [BR:ajs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ajs_1067
Lipid biosynthesis proteins [BR:ajs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ajs_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1120761..1122758
Genome map
AA seq 665 aa AA seqDB search
MSASSNAIESVLVENRVFPPADSVVKAARVSGMAGYEALCAEANKDPEGFWARLAREHLQ
WTKPFTQTLDESKAPFYRWFADGELNASANCLDKHMGTPVENKAAILFEADDGTVTQVTY
RQLLERVSQFANALKAHGVQQGDRVLIYMPMGVEGVVAMQACARIGATHSVVFGGFSAKA
LNERIIDAGAVAVITANYQLRGGKELPLKAIVDEGLSMGGCDSIKNVFVYQRTATACDMV
AGRDKTFSEILAGQSTECPPTPVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKVTME
WTFDIRPDDVFWCTADIGWITGHTYVAYGPLAAGATQVVFEGVPTYPNAGRFWQMIERHK
VTVFYTAPTAIRSLIKAADSDESVHPKNWDLSSLRILGSVGEPINPEAWMWYYRHVGGER
CPIVDTFWQTENGGHVITPLPGATPLVPGSCTLPLPGIQAAIVDETGKDLPNGAGGMLVI
KRPWPSMIRTIWGDPERFKKSYFPEELGGTTYLAGDGAVRSADRGYFRITGRIDDVLNVS
GHRMGTMEIESALVAKTDLVAEAAVVGRPDDLTGEAICAFVVLKRSRPTGEEAKQIATEL
RNWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEPITQDTSTLENPAILDQ
LAQSN
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcgtccaatgccatcgaatccgtattggtggagaaccgcgtcttcccgcct
gccgatagcgtggtgaaggcggcccgcgtgtcgggcatggccggctacgaggccctgtgc
gccgaagccaacaaggatcccgagggcttctgggcgcgcttggcgcgcgagcacctgcaa
tggaccaagccgttcacgcagacgctggacgagtccaaggcgccgttctaccggtggttt
gccgacggcgagctcaacgccagtgccaactgcctggacaagcacatgggcacgccggtc
gagaacaaggccgccatcctcttcgaggccgacgacggcaccgtcacccaggtcacttac
cggcaactgctggagcgcgtgagccagttcgccaatgccttgaaggcgcatggcgtgcag
cagggcgaccgcgtgctcatctacatgccgatgggcgtggaaggcgtggtggccatgcag
gcctgtgcgcgcatcggcgccacgcacagcgtggtgttcggcggtttctctgccaaggcg
ctgaacgagcgcatcatcgatgcgggcgccgtggcggtgatcacggccaactaccaattg
cgcggcggcaaggaactgcccctgaaggccatcgtggacgagggtctgtccatgggcggc
tgcgacagcatcaagaatgtcttcgtataccagcgcacggccacggcctgcgacatggtg
gcggggcgtgacaagaccttctccgagatcctggccgggcagagcaccgaatgcccaccc
acgcccgtgggcgcggagcatccgctgttcatcctctacaccagcggctccacgggcaag
cccaagggcgtgcagcacagcaccggcggctacctgctgtgggccaaggtgacgatggag
tggaccttcgacattcgccccgacgacgtgttctggtgcacggccgatatcggctggatc
acgggccacacctacgtggcctacggtccgctggctgcgggtgccacacaggtggtgttc
gagggcgtacccacgtaccccaacgccgggcgcttctggcagatgatcgagcgccacaag
gtcacggtgttctacacggcgcccactgccatccgctcgctcatcaaggcggccgactcc
gacgagagcgtgcaccccaagaactgggatctgtcgagcctgcgcatcctgggcagcgtg
ggcgagcccatcaaccccgaggcctggatgtggtactaccgccatgtgggcggcgagcgc
tgtcccatcgtggacacgttctggcagaccgaaaacggcggccacgtcatcaccccgctg
ccgggtgccacgccgctcgtgccgggttcgtgcaccttgccgctgccgggcatccaggcc
gccatcgtcgatgaaaccggcaaagacctgcccaacggcgcgggcggcatgctcgtgatc
aagcggccctggccctcgatgatccgcaccatctggggcgaccccgagcgcttcaagaaa
agctacttccccgaagagttggggggcaccacctacctggccggcgacggcgccgtgcgc
agtgccgaccgtggctacttccgcatcacgggccgcatcgacgacgtgctgaacgtgtcg
ggccaccgcatgggcacgatggagatcgagtccgccctggtcgccaagacggacctcgtg
gccgaggccgccgtggtgggccgtcccgacgacctgacgggcgaggcgatttgcgccttc
gtggtgctcaagcgctcgcgccccacgggcgaggaggccaagcagatcgccaccgaactg
cgcaactgggtcgccaaggagatcggccccatcgccaagcccaaggacatccgcttcggt
gacaacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgctcgatcgcc
aagggcgaacccatcacccaggacaccagcaccctggaaaaccccgcaatcctggatcag
ttggcgcagtccaactga

DBGET integrated database retrieval system