KEGG   Acidovorax sp. JS42: Ajs_1158Help
Entry
Ajs_1158          CDS       T00455                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ajs  Acidovorax sp. JS42
Brite
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Ajs_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1222958..1224481)
Genome map
AA seq 507 aa AA seqDB search
MASAKSPSEIARETLKLLATRRLPPTPDHYQALYDEVAGTTSAPAFPSAQLRQISRVIPG
QTPAQKRLLGLLETAITQQDWGVLQNVLVGYANLGLSPVAAPEPASTRIDHLPLTLAQNL
ARLVDNTLPALGEDDARVHELAAQLSTFLREPDPPVSTAELMLGNFSYRLSFAAEDQAAI
RLSLLSLLRLVFENIAALSMDDEWLHGQAEALLAASTPPLTLRRLDDVQRRLKDVIFKQT
EAKERTVHAQMQMRELLATFIERLAQMDESSSAYNTKMEDCAERISQATQLQDIMPLLEE
VMAATRAMALSSRVTRGELQELRERTEAKHAEIDHLRQELDRASAQARHDPLTGSLNRKG
FAEAMEREIARARRQDAPLCVALLDVDNFKSINDRLGHTAGDAALVHLAQVTREVMRPQD
QLARYGGEEFVIILPDTELAEGVKAMERLQRELTTRYFLKDQERVLITFSAGVAQVEGEE
GSADAIRRADQGMYLAKRTGKNRVVAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgccaaatccccttctgaaattgcccgcgagacgctcaagctactcgctacg
cgccggcttcctcccacgcccgaccactaccaggccctctatgacgaagtggccggcacc
accagcgcgccggcgtttcccagcgcccagctgcggcagatctcgcgggtgatccccggc
cagaccccggcgcagaagcggttgctgggcctgttggaaaccgccatcacccagcaggac
tggggcgttttgcaaaacgtgttggtgggatacgccaacctgggactctcgcccgtggcc
gcgcccgagcccgcgagcacccggattgaccacctgccgctgacactggcgcagaatctg
gcgcggctggtggacaacaccctgccggcgctgggcgaggacgatgcccgcgtgcatgag
ctggctgcgcaattgagcaccttcctgcgcgagcccgacccacccgtctccaccgccgag
ctgatgctcggcaacttcagctaccgcctgtctttcgcggcggaagaccaagccgccatc
cggctgagcttgctcagcctgctgcgcctggtgttcgagaacattgccgccctgagcatg
gacgacgagtggctgcacggccaggccgaggcgctgcttgcggcctccaccccgccgctc
acgctgcgccggctggacgacgtgcagcgacgcctcaaggacgtcatcttcaagcagact
gaggccaaggaacgcaccgttcacgcgcagatgcagatgcgcgaactgctggccacgttc
atcgagcgcctggcgcagatggatgaatccagcagcgcctacaacaccaagatggaggat
tgcgccgagcgcatcagccaggctacgcaactgcaggacatcatgccgctgctggaggaa
gtcatggccgccacgcgcgccatggcgctgagcagccgggtgacgcgcggcgaactgcag
gaactgcgcgagcgcaccgaggccaagcacgccgaaatcgaccacctgcgccaggagctg
gaccgcgcgagcgcccaggcgcgccacgacccgttgacgggctcgctcaaccgcaagggc
tttgccgaggccatggagcgcgagatcgcgcgtgcgcgccgccaggatgcgccgctgtgc
gtggcgctgctggatgtggacaacttcaagtccatcaatgaccgcctgggccacaccgcc
ggcgacgcggcactggtgcatctggcgcaggtcacccgcgaggtgatgcgaccgcaggac
cagttggcgcgctatggcggcgaggaattcgtcatcatcctgcccgacaccgaactggcg
gaaggcgtgaaggccatggagcgcctgcaacgcgagctgaccacgcgctacttcctcaaa
gaccaggagcgggtgctcatcaccttcagcgccggtgtggcccaggtggagggcgaagaa
ggcagcgccgacgcaatccgccgcgccgaccagggcatgtacctggccaagcgcaccggc
aaaaaccgcgtggttgctgcctga

DBGET integrated database retrieval system