KEGG   Acidovorax sp. JS42: Ajs_1161Help
Entry
Ajs_1161          CDS       T00455                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ajs  Acidovorax sp. JS42
Brite
Enzymes [BR:ajs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ajs_1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1226468..1227238
Genome map
AA seq 256 aa AA seqDB search
MQRRPGFPARIDWRQPGAPTAAPPVGARREVQPPTPHGVGLDSAAVRARMVQRLAASGIS
AGAVLQAMGMIERHRFVDTALANQAYEDTSLPIGLGQTISKPSVVARMIELLLGAECARG
KGMGRVLEIGTGCGYQAAVLSRVSREVYTVERLRALHEKARDHLRPLRLANVHLILGDGM
LGYPSGAPYAGIIAAAGGDSLPAAWCEQLAVGGRLVAPLAGADGQQMLLVVDKTAQGFKQ
GILEAVHFVPLKSGIA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggcggccaggttttcctgcgcggatcgactggcgccaacccggtgcacccacc
gcggcgccaccggtaggcgcgcgccgcgaggtgcagccgcccacgccgcacggcgtgggg
ctggactccgctgccgtgcgcgcacgcatggtgcagcgactcgcagcctcgggcatctcg
gcgggggcggttcttcaggccatgggaatgattgagcggcatcgttttgtcgacaccgcc
ttggccaaccaagcctatgaggacaccagtctgcccatcggactgggtcagaccatttcc
aaacccagcgtcgtagcacgcatgatcgaattgttgctgggggccgagtgcgcgcgcgga
aagggaatgggccgggtgctggagatcggcacgggctgcggctatcaggcagcggtgctg
tcgcgtgtctcgcgcgaggtgtataccgttgaacgcttgcgcgcgttgcatgaaaaggcg
cgagaccacttgcgccccctgcgcctggccaacgtgcacctgatcctgggcgacggaatg
ttgggttaccccagcggcgcgccctatgcgggcattattgccgcggcggggggggatagc
cttcccgccgcgtggtgcgagcaacttgccgtgggtggccggctggtcgccccactggcg
ggcgccgacggccaacagatgctgctggtcgttgataaaactgcgcaaggcttcaagcag
ggcattctggaagccgtgcatttcgtccccctaaaatcggggatcgcctga

DBGET integrated database retrieval system