KEGG   Acidovorax sp. JS42: Ajs_1507Help
Entry
Ajs_1507          CDS       T00455                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ajs  Acidovorax sp. JS42
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ajs_1507
Enzymes [BR:ajs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ajs_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1561264..1562799)
Genome map
AA seq 511 aa AA seqDB search
MSDHAMNEQRDHDTRLRAWRTGIDTYQEPIVYMRSDCVVCRSEGFTTQTRVLLTAGTRSA
VATLNVVEGNWLAPGVAGLSEAAWHALDPAADAWINVSYAPTLDSLSHVRAKVYGHRLDA
GAFNAVIGDVAAGRYSDLYLAAFVTACAGDRLDLSETVALTRAMVAVGHRLDWGRETVVD
KHCVGGLPGNRTTLLVVPIVAACGLTMPKTSSRAITSPAGTADTMEVLAPVNLDIAAMRR
TVERTGGCIVWGGSVRLSPADDVLIRVERPLDLDSEGQLVASVLSKKAAAGSTHVLIDLP
VGPTAKVRSTEAAQSLGRRLVEVGRAIGLQVTLRITDGLQPVGRGVGPALEARDVLAVLR
GQADAPDDLRQRALRLAGDILELGGAAPNGSGLQLAAEVLADGRAWAKFQAICEAQGGLR
EVPVTPYRQVITAAVAGRVAAIDNRVLARAAKLAGAPKAPAAGVDVHARIGDPVQAGQPL
FTLHAQTAGELDYAGHFVDTRPPIFQISEEA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccacgccatgaacgagcagcgcgaccatgacaccaggctgcgcgcctggcgc
accggcatcgacacctaccaggagcccatcgtctatatgcgcagtgactgcgtggtctgc
cgttccgagggcttcacgacgcagacgcgcgtgctgcttaccgccggcacccgcagcgcc
gtggccacgctgaatgtggtcgagggaaattggctggcccctggcgtcgcgggcctgtcc
gaggcggcctggcacgcgctcgatcctgccgccgacgcctggatcaacgtcagctacgca
ccgacgctcgattcgctgagccacgtgcgcgccaaggtctatggccaccgccttgatgcc
ggcgcattcaatgccgtgatcggcgacgtcgcggcaggccgctactccgacctgtacctg
gccgcattcgtcaccgcatgcgccggcgaccggctcgacctgtccgagaccgtggcgcta
acccgggccatggtcgccgtcggccaccggctcgactggggccgcgaaaccgtggttgac
aagcactgcgtcggtgggctgccaggcaaccgcaccaccttgctggtcgtgcccattgtc
gcggcctgcgggctgaccatgcccaagacatcctcgcgcgcgatcacttcgccggccggc
accgcagacacgatggaggtgctggcgccggtgaacctggacatcgccgcgatgcggcgc
accgttgagcgcaccggtggctgcatcgtgtggggtggctcggtgcggctgagtccggcc
gacgatgtgctgatccgcgtcgagcggccgctggacctcgacagcgagggccagttggtc
gcctccgttctgtcaaagaaagccgcagccggctccacccatgtgctgatcgacctgccg
gtaggcccgaccgccaaggtgcgcagcaccgaggccgcacagtcgctcggccgccgcctg
gtggaagtcggccgcgcgatcggcctgcaggtcactctgcgcatcaccgacgggttgcag
cccgtcggccggggtgtcggcccggcactggaagcacgcgacgtactggcggtgctgcgc
ggccaggccgatgcccccgatgatctgcgccagcgggccctgcgactggctggcgacatc
ctagagctgggcggcgctgcgcccaacggaagcggcctgcagctggccgccgaggtgctg
gccgacggccgcgcctgggccaagttccaggccatctgcgaggcgcagggagggctgcgc
gaggtgcccgtgacgccgtatcggcaggtcatcacggcagcggtggccgggcgggttgcg
gccattgacaaccgcgtgctcgcgcgcgcggccaaattggctggagcgccaaaggcgcca
gccgccggggtcgatgtgcacgcacgcatcggcgatccggtccaggccggccaaccgctg
ttcacgctgcatgcccagacggccggcgagctggactacgccgggcacttcgtggacacc
cgtccgcccatcttccagatctcggaggaagcatga

DBGET integrated database retrieval system