KEGG   Acidovorax sp. JS42: Ajs_1537Help
Entry
Ajs_1537          CDS       T00455                                 

Definition
periplasmic thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ajs  Acidovorax sp. JS42
Brite
Enzymes [BR:ajs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ajs_1537
Secretion system [BR:ajs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ajs_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1592976..1593824)
Genome map
AA seq 282 aa AA seqDB search
MMATTESARRIHRFASTALCAVLVAAAATAQAAQAAPSDETRLLAALRKAHPGTEFTEVS
RTEVSGLYEVWMNGNVAYVASANPRYFIFGRLFDTQAMRDITGPRIAQRSSPSNQDGRAQ
AEAVSVAPVPVDQLPLADAIKTVRGNGQRKLAVFSDPNCVYCKQLEPELAGLDNVTIYTF
LVPFQGEARPVAIWCAADRERAWRQWMLQADASLTQPGAQCEHPIARNLELARRLRVQGT
PTMIWADGSRTDGYVGRSVLEARFAEVGKVALAQPVKTEKRP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaactactgaatccgcgcgccggatccaccgcttcgcttcgacagcgctctgc
gcagtactagtggctgcggcggccacggcccaagccgcccaagccgcgccctccgacgaa
acccggctgctcgccgcgctgcgcaaagcccatccgggcaccgagttcaccgaggtatcg
cgcaccgaggtctcgggcctctacgaggtctggatgaacggcaacgtcgcctatgtcgcg
tcggcgaatccacgctacttcatcttcgggcggctgttcgacacccaggccatgcgtgac
atcaccggccccaggatcgcgcagcgctccagcccgtccaaccaggatggacgggcgcag
gcggaagccgtctccgtagcccctgtaccagtcgatcagttgccgctggccgacgcgatc
aagacggtgcgcggcaacggccagcgcaagctggccgtgttcagcgacccgaactgcgtc
tactgcaagcagctcgaacccgagctcgcaggcctggacaacgtcacgatctacaccttc
ctggtgccgttccagggcgaggcccggccggtcgccatctggtgcgccgccgaccgcgag
cgcgcctggcgccaatggatgctgcaggcggatgccagcctgacgcagccgggcgcgcag
tgcgagcacccgatcgcgcgcaaccttgagctggcgcgccggctccgcgtacagggaacg
ccgaccatgatctgggcggacggtagccgcaccgacggctatgtcgggcgctccgtgctt
gaggccaggttcgcggaggtcggcaaagtggccctggcccagccggtcaagacggagaag
cggccatga

DBGET integrated database retrieval system