KEGG   Acidovorax sp. JS42: Ajs_1823Help
Entry
Ajs_1823          CDS       T00455                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ajs  Acidovorax sp. JS42
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_1823
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ajs_1823
  Amino acid metabolism
   00310 Lysine degradation
    Ajs_1823
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ajs_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1897111..1898376
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKPGEAVAIDEILIEIETDKVVLEVPAPAAGVMAEI
VVADGGTVASDQVIAKIDTEGKAGAAAPAAAAAAPAPAAASAPAAAAPAAAGGSKGDVAM
PAAAKLLADNNLSVGDVTGSGKDGRVTKGDVLAAVAGGVKSTAAVIPTGVPTKALPQVAA
PASKEELGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMDLRKKFQDAF
TKEHGVKLGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIAEFGKKAADGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSA
ILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctgtccgagtccgtggccgaagccaccctg
ctgcagtggaagaagaagcccggcgaggccgtggcaatcgatgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgcccgcaccggccgccggcgtgatggccgagatc
gtggtcgccgacggcggcaccgtggcctccgaccaggtcatcgccaagatcgacaccgag
ggcaaggccggcgcggccgcgccggcagctgctgccgctgcaccggcgcccgcagcggca
tctgccccggcggccgctgcgcctgccgctgctggtggcagcaagggcgacgtggccatg
ccggccgccgccaagctgctggccgacaacaacctgtcggtcggcgatgtgacgggctcc
ggcaaggacggacgcgtgaccaagggcgatgtgctggccgcagtggcaggcggcgtgaag
tcgacggccgccgtgatccccaccggcgtgcccaccaaggccctgccgcaggtggccgcg
cccgcgtccaaggaagagctgggcgagcgccccgagcagcgcgtgcccatgagccgcttg
cgtgcccgcgtggccgagcgtctgctgcaatcgcagtccaccaacgccatcctcaccacg
ttcaacgaagtgaacatggcgccggtgatggacctgcgcaagaagttccaggacgcattc
accaaggagcacggcgtgaagctgggcttcatgtccttcttcgtgaaggccgcggtgcat
gccctcaagaagtacccggtgctcaacgcctcggtggacggcaacgacatcgtctaccac
ggctacttcgacatcggtatcgccgtgggctcgccgcgcggcctggtggtgcccatcctg
cgcaacgcagaccagatgagctttgccgacatcgaaaagaagatcgccgaattcggcaag
aaggcggccgacggcaagctgggcatcgaagagatgaccggtggcacgttctccatctcc
aacggcggcaccttcggctcgatgatgtccacccccatcatcaacccgccgcagtcggcc
atcctgggcgtgcacgccaccaaggaccgcgccgtggtcgaaaacggccaggtcgtggtg
cgtccgatgaactacctggccatgtcttatgaccaccgcatcatcgacggccgcgaagcc
gtgctgggcctcgtggccatgaaggacgcgctggaagacccgtcgcgcctgttgttcgac
ctgtaa

DBGET integrated database retrieval system