KEGG   Acidovorax sp. JS42: Ajs_1889Help
Entry
Ajs_1889          CDS       T00455                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00010  Glycolysis / Gluconeogenesis
ajs00071  Fatty acid degradation
ajs00350  Tyrosine metabolism
ajs00625  Chloroalkane and chloroalkene degradation
ajs00626  Naphthalene degradation
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_1889
  Lipid metabolism
   00071 Fatty acid degradation
    Ajs_1889
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ajs_1889
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ajs_1889
   00626 Naphthalene degradation
    Ajs_1889
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ajs_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABM42069
UniProt: A1W744
Position
complement(1974225..1975256)
Genome map
AA seq 343 aa AA seqDB search
MPAKTMKAAVVREFGKPLTIEEVPVPTPAADQILVKIEASGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGFVAAVGANVKHVKEGDRVGVPWLHSACGRCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPNYVGRLPKDLGFVDIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGG
LGHMAVQYARAMGLNVAAVDVDDDKLALARQLGASVTVNARDTDPAAFLQKEIGGAHGAL
VTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLPIFDMVLRGVTVRGSIVGTRLDLQES
LDFAARGQVKATVRTEKLENINDVFARMHKGQIQGRVVLDMAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaagacaatgaaagccgccgtggtccgcgagttcggcaagccgctgacgatc
gaagaggtgcccgtgcccacccccgccgccgaccagattctggtgaagatcgaggcctcg
ggcgtgtgccacaccgacctgcacgccgccgagggcgactggcccgtcaagcccaatccg
cccttcatcccggggcacgagggcgtgggcttcgtcgccgccgtgggcgccaacgtcaag
catgtgaaggaaggcgaccgcgtgggcgtgccctggctgcactcggcctgcggccgttgc
acgcactgcctgggcggttgggagacgctgtgcgagtcgcagagcaacacggggtattcg
gtcaacggcggttttgccgactacgcgctggccgaccccaactacgtgggccgcctgccg
aaagacctgggcttcgtggacatcgcccccgtgctgtgcgccggcgtgaccgtgtacaaa
ggcctgaaggtgaccgacaccaagcccggcgactgggtggcgatttccggcattggcggc
ctgggccacatggccgtgcagtacgcccgcgccatggggctgaatgtggctgcggtggac
gtggacgacgacaagctcgcgctggcccgccagctgggcgccagcgtgacggtgaacgcg
cgcgacaccgacccggccgccttcctgcaaaaggagatcggcggcgcgcacggcgcgctg
gtcacggccgtgtcgcccaaggccttcgagcaggcgctgggcatggtgcggcgcggcggc
acggtgtcgctcaacgggttgccgccgggcaactttccgctgcccatcttcgacatggtg
ctgcgcggcgtgaccgtgcgcggctccatcgtcggcacgcggctggacctgcaggagtcg
ctggacttcgccgcgcgcggccaggtgaaggccacggtgcgcaccgagaagctggagaac
atcaacgacgtgttcgcgcgcatgcacaagggccagatccagggccgcgtggtgctggac
atggcggcctga

DBGET integrated database retrieval system