KEGG   Acidovorax sp. JS42: Ajs_1922Help
Entry
Ajs_1922          CDS       T00455                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ajs  Acidovorax sp. JS42
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ajs00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ajs00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ajs03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ajs03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ajs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2013395..2013835
Genome map
AA seq 146 aa AA seqDB search
MTQVAFHFNAPDKLAYVCRLVRKATRQDARVTVTGDADTLLRLDRQLWALAPSDFVGHCL
GDADEEILRASPTVLVQDPRTSPNRDVLVNLGNVLPEGFAQYARVVEVVSQVDEDDRKRA
RERWRGYAALGYDIVRHDLVLKESAG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggtggcattccacttcaatgcacccgacaaactggcgtatgtctgtcgcctg
gtgcgaaaagccacccggcaggatgcgcgggtgacggtcacgggtgatgcagacaccttg
ctgcggctggatcgccagctctgggcgttggcgccttcggatttcgtcggccattgcctg
ggagacgccgacgaggaaattctgcgtgcctctcccaccgtgttggtgcaagaccctcgt
accagtccgaatcgggacgtgttggtcaacctgggaaatgtcttgcccgagggatttgcg
cagtacgctcgggtcgtggaggtggtcagccaggtggatgaggatgatcggaagcgcgcg
cgggagcgctggcgcggctatgccgcgctggggtatgacatcgttcgccacgatctggta
ctcaaggaaagcgcgggatga

DBGET integrated database retrieval system