KEGG   Acidovorax sp. JS42: Ajs_2001Help
Entry
Ajs_2001          CDS       T00455                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ajs_2001
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ajs_2001
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ajs_2001
Enzymes [BR:ajs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ajs_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2102694..2103875)
Genome map
AA seq 393 aa AA seqDB search
MPDAAGFFGPYGGQLVPPHLKAAMDDIAAAYAEITQRKDFQDELAQLFADYVGRPSPIFH
AKRLSGLLGGAQIHLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETGAGQHGVALA
TACALVGIPCEIHMGQVDIEKEHPNVTKMRILGCKLVAVTRGAATLKEAVDSAFEEYLTN
PTDYLYAIGSVVGPHPFPMMVRDFQSIIGREAREQFQARHGRLPDYVTACVGGGSNAMGM
FTAFLGDTDVKLVGVEPSGEGTDKPGRHAATLSMGQPGEIHGMKCYVLEDAPGVPAAVHS
IASGLDYPGVGPQHSYLKDIGRVQYEAVTDKECLDAFMQLSRVEGIIPALESAHAVAWAI
RVAPTLPQDQHILVNLSGRGDKDADYVAKVLGL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgccgccggcttctttggcccctacggcgggcagcttgtgccgccgcacttg
aaagccgccatggacgacatcgccgcggcctatgccgagatcacgcagcgcaaggacttc
caggacgagctggcacagctgtttgccgattacgtgggccggcccagcccgatctttcat
gccaagcggctttcgggcctgctgggcggcgcgcagatccacctcaagcgcgaggacctg
aaccacaccggcgcgcacaagatcaaccactgtctgggcgaggcgctgctggccaagttc
atgggcaagaagaaggtgattgccgagacgggcgccggccagcacggcgtggcgttggcc
acggcctgtgcgctggtgggcattccgtgcgagatccacatgggccaggtggacatcgag
aaggagcaccccaacgtcaccaagatgcgcatcctgggctgcaagctggtggcggtgacg
cgcggcgcggccacgctgaaggaggcggtggacagcgccttcgaggagtacctgaccaac
cccaccgactacctgtacgccatcggctcggtggtggggccgcacccgttcccgatgatg
gtgcgcgacttccagagcatcatcggccgcgaggcgcgcgagcagttccaggccagacac
ggccgcctgcccgactacgtgaccgcctgcgtgggcggcggcagcaatgccatgggcatg
ttcaccgccttcctgggcgataccgatgtgaagctggtgggcgtggagccctcgggcgaa
ggcaccgacaagcccggccggcacgcggccacgctgagcatgggccagcccggtgagatc
cacggcatgaagtgctatgtgctggaggatgcgccgggcgtgcccgccgccgtgcacagc
attgcctcgggcctggactaccccggcgtgggcccgcagcacagctatctgaaggacatt
ggccgcgtgcagtacgaagccgtgaccgacaaggaatgtctggacgcgttcatgcagctg
tcgcgcgtggaagggatcatccccgcgctggagagcgcccatgccgtggcctgggccatc
cgcgtggcgcccacgctgcctcaggaccagcacatcctggtcaacctgtcgggccgcggt
gacaaggatgcggattacgtcgccaaggtgctggggctttga

DBGET integrated database retrieval system