KEGG   Acidovorax sp. JS42: Ajs_2069Help
Entry
Ajs_2069          CDS       T00455                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ajs  Acidovorax sp. JS42
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ajs_2069
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ajs_2069
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ajs_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2181459..2182634
Genome map
AA seq 391 aa AA seqDB search
MSPTLLLTEQLIARPSVTPDDAGCLDLLARRLAPLGFACERLDSGPENFRVSNLWSKRSA
ALSGQAQAATKTVVFAGHTDVVPTGPVEQWSSPPFTPTHRDGRLYGRGASDMKASIAAFV
VAVEEFLAATPDPRLDIALLLTSDEEGPSVDGTKVVIEQLRARGERLDWCIVGEPTSVEQ
TGDMIKNGRRGTLSGRLTVRGVQGHIAYPQLARNPIHQAVPALTELAATVWDMGNAFFPP
TSWQMSNIHGGTGATNVIPGQVVIDFNFRFSTESTAEGLQQRVHAVLDRHGLEYDLTWTL
GGQPFLTTPGELVQAVQQAIRAETGLETELSTTGGTSDGRFIAQICPQVIELGPPNASIH
KIDENVRLVDIEPLKNIYRRTLEHLNALAGA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccaccctgctactgaccgaacagctcatcgcccgcccctccgtcacgcccgac
gacgcgggctgcctggacttgctggcccggcgcctcgctcccttgggctttgcctgcgag
cgactggacagcgggcccgagaacttccgcgtcagcaatttgtggtcaaaacgcagtgca
gcgctctctggacaagcgcaagcagctaccaaaacagtagtattcgccggccacaccgac
gtggtgcccacgggccccgtggagcagtggagcagcccgccgttcacccccacacaccgg
gacggccgcctgtacggccgcggcgcgagtgacatgaaggcctcgatcgccgcattcgtt
gtcgcggtcgaggagttcctggccgccacgcccgacccgcgcctggatatcgcgctgctg
ctgaccagcgacgaggaaggcccctcggtggacggcaccaaggtggtcattgagcagttg
cgcgcgcgcggggagcggctggactggtgcatcgtgggcgagcctacctcggtcgagcag
accggcgacatgatcaagaacggccgccgcggcacgctgtccgggcggctcaccgtgcgg
ggggtgcagggccacatcgcctacccgcagctggcgcgcaaccccatccaccaggccgtg
cccgcgctcaccgagctcgccgccaccgtgtgggatatgggcaacgccttctttccgccg
accagctggcagatgagcaacatccacggcggcaccggtgcgaccaacgtgatccccggc
caggtggtgatcgacttcaacttccgcttcagcaccgaatcgaccgccgaagggctgcag
cagcgcgtgcatgcggtactggaccgccacggactggaatacgacctgacctggacgctg
ggcggccagcccttcctgaccacgccgggcgaactggtgcaggcggtgcagcaagccatc
cgcgccgagaccgggttggaaaccgagctgtccaccaccggcggcaccagcgacgggcgc
ttcattgcccagatttgcccccaggtgatcgagctgggcccgcccaacgccagcatccac
aagatcgacgagaacgtgcgcttggtcgacatcgagccgctcaagaacatctaccgccgc
acgctcgagcatctcaacgcactggcgggcgcatga

DBGET integrated database retrieval system