KEGG   Acidovorax sp. JS42: Ajs_2124Help
Entry
Ajs_2124          CDS       T00455                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00010  Glycolysis / Gluconeogenesis
ajs00020  Citrate cycle (TCA cycle)
ajs00620  Pyruvate metabolism
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01200  Carbon metabolism
Module
ajs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_2124
   00020 Citrate cycle (TCA cycle)
    Ajs_2124
   00620 Pyruvate metabolism
    Ajs_2124
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ajs_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C RnfC_N NQRA HlyD_D23 DUF4813
Motif
Other DBs
NCBI-ProteinID: ABM42293
UniProt: A1W7R8
Position
complement(2244233..2245936)
Genome map
AA seq 567 aa AA seqDB search
MALVNIQVPDIGDFDEVGVIELLVKVGDTVKAEQSLITVESDKASMEIPSSHAGVVKELK
VQLGDKVKQGSVIAVLEAAGEAAASDEKPAPAPAAQAPAAIETQAPVAPAAPAAPAAGGG
AVEVRVPDIGDFKDVAVIELLVQPGDAVKVEQSLFTVESDKASMEIPSPAAGVLKELKVK
IGDKINVGDLVAVLEGAAAAPAAAPAQGSTPAAASAPAAAAPVAAQGSAPAPAAATATAT
ATATAPVPAHQPSTPTPGLPHASPSVRKFARELGVPLAEVKGTGIKGRITQEDVAAFTRQ
VMSGALQTQAQGSKAPAAGGSGVGLDLLPWPKVDFAKFGPVERKELSRIKKISGANLSRN
WVMIPHVTNNDEADITELEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNASL
DGDALVYKQYFHIGFAADTPNGLVVPVLKDADKKGILQISAEMAELAKKARDGKLGAADM
QGGSMSISSLGGIGGTHFTPIINAPEVAILGLSKSQMKPVWDGQQFVPRLTLPLSLSYDH
RVIDGASAARFNAYLGQVLADYRRILL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcattggtaaacatccaggttcccgacatcggcgacttcgacgaggtcggcgtgatc
gagctgctggtcaaagtgggcgacacggtgaaggccgagcagtcgctgatcaccgtggag
tccgacaaggcctcgatggaaatcccgtcgagccacgcgggtgtggtcaaggaactcaag
gtccagctgggcgacaaggtcaagcaaggcagcgtgatcgccgtgctggaggccgcgggc
gaagcggctgcttctgatgaaaaaccggctccagcgcccgccgcacaagcgccggcagct
atcgaaacgcaagcgccggtcgcgcctgcagcacccgccgcccctgctgcgggtggtggc
gcggttgaggtgcgtgtgcccgacatcggtgacttcaaggacgtcgccgtgatcgagttg
ctggtccagcccggcgatgcggtcaaggtggagcagtcgctgttcaccgtggagtccgac
aaggcctcgatggagatcccttcgcccgccgccggcgttctcaaggagctcaaggtcaag
atcggcgacaagatcaacgtgggcgacctcgtggcggtgcttgaaggtgccgccgctgca
cctgccgccgccccggcgcagggttctacaccagcggccgcttctgctccggccgctgcc
gcgcccgtggcggctcagggctccgcgcccgcaccggctgcggcaacggcaacggcaacg
gcaacggcaacggcgcccgtgccggcccaccagccctcgacgcccacgccgggcctgccg
cacgccagcccctcggtgcgcaagttcgcccgcgaactgggtgtgccgctggcggaggtc
aagggcacgggcatcaagggccgcatcacgcaggaagatgtggcggccttcacgcgccag
gtgatgagcggtgcgctgcagacccaggcgcagggcagcaaggcgcccgctgcgggtggc
tcaggggtgggcctggacctgctgccgtggcccaaggtggacttcgccaagttcggcccc
gtcgagcgcaaggagctgtcgcgcatcaagaagatcagcggcgccaacctgtcgcgcaac
tgggtgatgattccccacgtcaccaacaacgacgaggccgacatcaccgagctggaagcc
ttccgcgtctccaccaacaaggagaacgagaagagcggcgtcaaggtcaccatgctggcc
ttcgtcatcaaggccgtggtcgcggcgctgaagaagttccccgagttcaacgccagcctg
gacggcgacgcgctggtctacaagcagtacttccacatcggctttgcggccgacacgccc
aacggcctggtggtgcccgtgctgaaagatgccgacaagaagggcatcctgcaaatcagc
gccgagatggccgagctggccaagaaggcccgcgacggcaagctgggtgcggccgacatg
cagggcggcagcatgtcgatcagctcgctgggcggcattggcggcacgcatttcaccccc
atcatcaatgcgcccgaggtggccatcctcggcctgtccaagagccagatgaagcccgtg
tgggacggccagcagttcgtgccgcgcctcacgctgccgctgagcctgtcgtacgaccac
cgcgtgatcgacggcgcctctgccgcgcgcttcaacgcctacctgggccaggtgttggcg
gactaccgccgcatcctgctgtaa

DBGET integrated database retrieval system