KEGG   Acidovorax sp. JS42: Ajs_2271Help
Entry
Ajs_2271          CDS       T00455                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ajs  Acidovorax sp. JS42
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ajs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2402625..2403272
Genome map
AA seq 215 aa AA seqDB search
MVRRDFIVAGALALWGAAPALAQSGGKKPTRAPVILVVGDSLSAEYGLPRGTGWVALLDK
RLAQEKIPATVVNASVSGDTTAGGRARLAALLQQHRPTHVVIELGGNDALRGLPLASTQG
NLAWMTEQAQAAGARVLLVGVQVPPNYGANYTRQFAEVFENVAQERKAALVPFLLKGVAD
GPDPTALFQPDRIHPTAQAHPRMLDNVWPALRALL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggttcggcgtgactttatcgtggcgggcgcactggccctgtggggcgcggcgcccgcc
cttgcgcagtccggtggcaagaagcccacccgcgcccccgtgatcctggtggtgggcgac
tcgctcagcgccgaatacggccttccgcgcggcaccggctgggtggcgctgctggacaag
cggctagcgcaggagaagatccccgccacggtggtcaacgccagcgtgagcggcgacacc
accgccggcggccgtgcgaggctggccgcactgctccagcagcaccggcccacgcatgtg
gtgatcgaactcggcggcaacgacgccttgcgcggcctgccgctggccagcacccagggc
aacctggcgtggatgaccgaacaggcccaggccgcgggcgcgcgcgtgctgctggtgggt
gtgcaggtgccgcctaactacggtgccaattacacccggcagttcgccgaggtcttcgag
aacgtggcccaggagcgcaaggcagcgctcgtgcccttcttgctcaagggcgtggccgat
gggcccgatcccacggcgctgttccagcccgaccgcatccaccccacggcccaggcgcac
ccgcgcatgctggacaacgtgtggcccgcgctgcgcgcgttgctgtaa

DBGET integrated database retrieval system