KEGG   Acidovorax sp. JS42: Ajs_2794Help
Entry
Ajs_2794          CDS       T00455                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ajs  Acidovorax sp. JS42
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_2794
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ajs_2794
   00650 Butanoate metabolism
    Ajs_2794
  Energy metabolism
   00190 Oxidative phosphorylation
    Ajs_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2957470..2957835
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGIRDWLAQRVTAALMALFTIALLAQVIFSKGPIGYDRWAGIFST
QWMKVLTFSVIVALVWHVWVGVRDVWMDYVKSAGLRLLLQVFTIVWLVACAGWGFQTLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgtggtcggtgcccactacggcatccgcgac
tggctggcccagcgcgtgaccgccgccctcatggccctgttcaccatcgcgctgctggcg
caggtgatcttcagcaagggccccatcggctacgaccgctgggccggcattttctcgacc
cagtggatgaaggtgctcacgttctccgtcatcgtggccctggtctggcacgtctgggtc
ggcgtgcgcgacgtgtggatggactacgtgaagtccgccgggctgcgcctgctgctgcag
gtcttcaccatcgtctggctggtggcctgcgccggctggggcttccagactctgtggcgt
ctctga

DBGET integrated database retrieval system