KEGG   Acidovorax sp. JS42: Ajs_2891Help
Entry
Ajs_2891          CDS       T00455                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ajs  Acidovorax sp. JS42
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ajs_2891
Enzymes [BR:ajs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ajs_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3064668..3065486
Genome map
AA seq 272 aa AA seqDB search
MPVQPPRAIVTRPAREATQWAADLQARGIAALALPLIAIGPVTNPALREELQQARARMDR
YCAVMFVSGNAAQYFFESNMPLTLSGQALAAIKTRVWAPGPGTVAALVQAGVAPERIDAP
GADAAQFDSEALWQVVAPQIGPGDRVLIVRGANAPTAEGGNGREWLARQIAAAGGAVDFV
AAYERGAPCLDAQQLVLAQAAASDGSVWLLSSSEAIANLRAVLPAQHWGMARALTTHPRI
AQAARAAGFGSVHECRPAFDEVTASIESLYEQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtgcagccgccccgggccatcgtcacgcgccccgcgcgcgaggccacgcagtgg
gccgccgatctgcaggcgcgcggcatcgccgcgctggcgctgccactcatcgccatcggc
ccggtgaccaacccggctctgcgcgaggaactgcaacaggcccgcgcacggatggaccgc
tactgcgcggtgatgttcgtgagcggcaacgcggcgcagtatttctttgaatcaaatatg
cctctaacgctttctggacaagcgttagcagctatcaaaacgagagtatgggctcccggc
cccggcaccgtggcggcactcgtgcaggccggggttgcgcccgagcgcattgacgctccc
ggcgccgacgccgcgcagtttgactccgaggccctgtggcaggtggtcgcgccgcagatc
ggcccgggcgaccgcgtgctcatcgtgcgtggagccaacgcccccacggccgagggcggc
aacgggcgcgaatggctagcccggcagatcgccgctgcgggtggcgcggtggacttcgtc
gccgcgtacgagcgcggcgcaccctgcctcgacgcccagcaactggtgctggcgcaagca
gccgccagcgacggctcggtctggctgctgagcagttccgaggccatcgccaacctgcgt
gctgtgttgcccgcgcaacactggggcatggcccgcgccctgaccacccacccgcgtatc
gcgcaggccgcacgtgcggccggctttggcagcgtgcacgaatgccgtccggcgttcgat
gaagtgacagcctcgatagaatcgctttatgagcaatga

DBGET integrated database retrieval system