KEGG   Acidovorax sp. JS42: Ajs_3202Help
Entry
Ajs_3202          CDS       T00455                                 

Definition
(GenBank) molybdopterin synthase subunit MoaD
  KO
K03636  
sulfur-carrier protein
Organism
ajs  Acidovorax sp. JS42
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Ajs_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3386947..3387210)
Genome map
AA seq 87 aa AA seqDB search
MTTPFTITVRYFASIREAVGMGQETVQTGATTLGALRDELIARGEPWATCLSRGRAVRVA
LDQTMAHDATPLAAGAEAAFFPPVTGG
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccttcacgatcacggtgcgctacttcgcctccatccgcgaggccgtgggc
atggggcaggagacggtgcagaccggcgccaccacgctgggcgccttgcgcgatgaactc
atcgcccgtggcgagccctgggccacctgcctctcgcgcgggcgcgccgtgcgcgtggcc
ctcgaccagaccatggcgcatgacgccacgccgctggcggcaggcgccgaggcggcgttc
tttccgcccgtcacgggcggctga

DBGET integrated database retrieval system