KEGG   Acidovorax sp. JS42: Ajs_3202Help
Entry
Ajs_3202          CDS       T00455                                 

Definition
molybdopterin synthase subunit MoaD
Orthology
K03636  
molybdopterin synthase sulfur carrier subunit
Organism
ajs  Acidovorax sp. JS42
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ajs_3202
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Ajs_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3386947..3387210)
Genome map
AA seq 87 aa AA seqDB search
MTTPFTITVRYFASIREAVGMGQETVQTGATTLGALRDELIARGEPWATCLSRGRAVRVA
LDQTMAHDATPLAAGAEAAFFPPVTGG
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccttcacgatcacggtgcgctacttcgcctccatccgcgaggccgtgggc
atggggcaggagacggtgcagaccggcgccaccacgctgggcgccttgcgcgatgaactc
atcgcccgtggcgagccctgggccacctgcctctcgcgcgggcgcgccgtgcgcgtggcc
ctcgaccagaccatggcgcatgacgccacgccgctggcggcaggcgccgaggcggcgttc
tttccgcccgtcacgggcggctga

DBGET integrated database retrieval system