KEGG   Acidovorax sp. JS42: Ajs_3202Help
Entry
Ajs_3202          CDS       T00455                                 

Definition
molybdopterin synthase subunit MoaD
Orthology
K03636  
molybdopterin synthase sulfur carrier subunit
Organism
ajs  Acidovorax sp. JS42
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ajs00790]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:ajs04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3386947..3387210)
Genome map
AA seq 87 aa AA seqDB search
MTTPFTITVRYFASIREAVGMGQETVQTGATTLGALRDELIARGEPWATCLSRGRAVRVA
LDQTMAHDATPLAAGAEAAFFPPVTGG
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccttcacgatcacggtgcgctacttcgcctccatccgcgaggccgtgggc
atggggcaggagacggtgcagaccggcgccaccacgctgggcgccttgcgcgatgaactc
atcgcccgtggcgagccctgggccacctgcctctcgcgcgggcgcgccgtgcgcgtggcc
ctcgaccagaccatggcgcatgacgccacgccgctggcggcaggcgccgaggcggcgttc
tttccgcccgtcacgggcggctga

DBGET integrated database retrieval system