KEGG   Acidovorax sp. JS42: Ajs_3239Help
Entry
Ajs_3239          CDS       T00455                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ajs_3239
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ajs_3239
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ajs_3239
Enzymes [BR:ajs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ajs_3239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3423714..3424982
Genome map
AA seq 422 aa AA seqDB search
MPAYTQPDASGHFGPYGGSFVSETLTHAINELREAYARYQNDPEFLKEFHYELAHFVGRP
SPVYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKECLTQMPTMLAEQKIAAEQPDAVVA
CVGGGSNAMGIFHPYIPFEKTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIKRAEYVGITDTEALEAFHYLCRTEGIIPAL
ESSHAVAYALKLAKTMTPQQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGLTVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcatatacccaacccgatgcttcgggccattttggcccctatggcggcagcttc
gtctctgagacgctgacgcacgccatcaacgaactgcgcgaagcctatgcgcgctaccag
aacgacccggagttcctcaaggaattccactatgagcttgcgcacttcgtgggccgcccc
tcgccggtttaccacgcggcgcgcaccagccgcgagatgggcggcgcgcagatctacctc
aagcgcgaagacctgaaccataccggcgcacacaagatcaacaacgtgatcggccaggcc
atgctcgccaagcgcatgggcaagccgcgcatcattgccgagaccggcgccggccagcac
ggcgtggccaccgccaccatctgcgcgcgctatggcctggagtgcgtggtgtacatgggc
gccgaggacgtcaagcgccaaagccccaacgtctaccgcatgaagctgctgggcgccacc
gtggtgcccgtcgagtcgggcagcaagacgctgaaagatgcgctcaacgaggccatgcgc
gactgggtagccaacgtggacaacaccttctacatcatcggcaccgtggcaggcccccac
ccctatcccatgatggtgcgtgacttccagagcgtgatcggcaaggaatgcctcacgcag
atgcccaccatgctggccgaacagaagatcgccgccgagcaacccgacgccgtcgtggcc
tgcgtgggcggtggcagcaatgccatgggcatcttccacccctacatcccgttcgagaaa
acccgcctgatcggcgtggaagccgcaggcgaaggcctggacagcggcaagcattccgcg
agcctgcagcgcggctccagtggcgtgctgcacggcaaccgcaccttcatcctgcaagat
gagaatggccagatcacggagacgcacagcatcagcgccggcctggactaccccggagtg
ggccccgagcacgcctggctgcaggaaatcaagcgagccgagtacgtgggcatcaccgat
acggaagcgttggaagcctttcactacctgtgccgcaccgagggcatcatcccggccctt
gaatccagccacgccgtagcctacgcgctcaagctcgccaagaccatgacgccccagcaa
tccatccttgtgaacctgtccggccgcggcgacaaggacatcggcaccgtggccgacctg
tctggcgtggacttctacgaccgtccctccatgcgcgggttgaccgtcaagggaggaccc
gccgcatga

DBGET integrated database retrieval system