KEGG   Acidovorax sp. JS42: Ajs_3260Help
Entry
Ajs_3260          CDS       T00455                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_3260
   01230 Biosynthesis of amino acids
    Ajs_3260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_3260
   00030 Pentose phosphate pathway
    Ajs_3260
   00051 Fructose and mannose metabolism
    Ajs_3260
   00052 Galactose metabolism
    Ajs_3260
  Energy metabolism
   00680 Methane metabolism
    Ajs_3260
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ajs_3260
Protein phosphatases and associated proteins [BR:ajs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ajs_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3444551..3445603)
Genome map
AA seq 350 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVTKSLIHHGHCEVLGIEDGFEGLRGEASRARLLTWDQVS
GIVHMGGTILGTSNSANPLKDEATLAQVERNVRALGLDVVVAIGGDGTMSLAHGLARIGL
QCVGVPKTIDNDIALCERSFGFDTAVATATDAMRRIESTAYSHHRVMIVETMGRHAGWLA
LESGIAAAADVILLPEIDYDLQPIIERCRRREQRQRYTVICIGEGAKERGAGLTVREQVA
HSPDPVRLGGVGHVLRQRLQPHLQSEVRTTVLGHVQRGGDPTAFDRVLATRFGHRAAQLV
IDGQFGHMVTLQGGHIASVPIAQVANTQRKVPLDHELIAMARAIDVCLGE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcggcgtactcaccggcgggggcgactgcccggggctgaacgcggtgatccgc
gcggtcaccaagtcgctgatccaccacggacactgcgaggtactgggcatcgaagacggc
ttcgagggcctgaggggcgaagcgtcgcgcgcgcggctgctcacctgggaccaggtctcg
ggcatcgtgcacatgggcggcaccatcctgggcacgagcaacagcgccaacccgctgaag
gacgaagcgacgctggcccaggtggagcgcaacgtgcgcgcgctgggcctggacgtggtg
gtggccattggcggcgacggcaccatgagcctggcccatggcctggcgcggatcgggctg
caatgcgtgggcgtgcccaagaccatcgacaacgacatcgcgctgtgcgagcgcagcttc
ggctttgacaccgccgtggccacggccaccgacgcgatgcgccgcatcgagagcacggct
tacagccaccaccgcgtcatgatcgtcgagaccatgggccgccatgcaggctggctggcc
ctggaaagcggcattgccgccgcggccgacgtgatcctgctgcccgagatcgactacgac
ctgcagcccatcatcgagcgctgccgtcggcgcgagcagcgccagcgttacaccgtcatc
tgcatcggcgaaggcgccaaggagcgcggcgccggcctcacggtgcgcgagcaggtggcc
cacagccccgaccccgtgcgcctgggtggcgtgggccatgtgctgcgccagcggctgcag
ccgcacctgcaaagcgaggtgcgcactaccgtgctgggccatgtgcagcgcgggggcgac
ccgaccgcgttcgatcgtgtgctggccacgcgcttcggtcaccgggcggcgcaactggtg
atcgatggccagttcggccacatggtcacgctacagggcgggcacatcgccagtgtcccc
atcgcccaggtggccaacacccagcgcaaggtgccgctggaccatgaactgatcgccatg
gcgcgggcgatcgacgtgtgcctgggggagtag

DBGET integrated database retrieval system