KEGG   Acidovorax sp. JS42: Ajs_3261Help
Entry
Ajs_3261          CDS       T00455                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ajs  Acidovorax sp. JS42
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ajs_3261
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Ajs_3261
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ajs_3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3445618..3446727)
Genome map
AA seq 369 aa AA seqDB search
MQPMTEHAPLIIDVAGTQLTATDRQRLAHPLVGGVILFARNWEHRAQLLELTAAIKAVRG
DLLICVDHEGGRVQRFKTDGFTHIPPMRAFGELWMDDGKGSKHREGSGALRAMDAATAAG
YVLGSELRACGVDFSFTPVLDLDYGASGVIGDRAFARDPRVVAMLARALMQGLLQAGMAN
CGKHFPGHGFVKADSHTEIPVDRRSLTAILADDAAPYPWLSTVLTSVMPAHVIYPKVDNR
PAGFSTKWLQDILRGRLRFDGAVFSDDLSMEGARRLNGLDGEVVSYTDAGVAALNAGCDL
VLLCNQSLGGGAAVDELIDGLAAAQAAGRWQASGASEARRLALLPETLPQPWDDLMVQPA
YMHALDLLP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccatgacagaacacgcacccctcatcatcgacgtggccggcacgcagctcacc
gccaccgatcgccagcgcttggcccacccgctcgtgggcggcgtgatcctgttcgcgcgc
aactgggagcaccgcgcgcagttgctggaactcaccgccgccatcaaggccgtgcggggc
gacctgctgatctgcgtggaccatgagggcggtcgcgtgcagcgcttcaagaccgatggc
ttcacgcacatcccgcccatgcgtgccttcggcgagctgtggatggacgacggcaagggc
agcaagcaccgcgaaggcagcggcgccctgcgcgccatggacgccgccacggcggcgggc
tacgtgctgggcagcgagctgcgcgcctgcggtgtggacttctccttcacgccggtgctc
gacctggactacggcgccagcggcgtgatcggcgaccgggcctttgcccgcgacccgcgc
gtggtcgccatgctggcgcgcgcgctcatgcagggcctgctgcaggcgggcatggccaac
tgcggcaagcattttcccggccatggcttcgtcaaggccgattcgcacaccgagattccg
gtggaccgccgcagtctcacggcgatcctggccgacgacgcggccccgtacccgtggctg
tccacggtgctcaccagcgtcatgcccgcgcatgtgatctaccccaaggtggacaaccgc
ccggcgggcttctccaccaagtggctgcaggacatcctgcgcggacggctgcgctttgac
ggcgccgttttcagcgacgacctgagcatggagggcgcccgtcgtttgaacggcctggac
ggcgaggtggtcagctacaccgacgccggcgtggccgcgctcaatgccggctgcgacctg
gtgctgctgtgcaaccagagcctgggcggcggcgcggcggtggacgaactcatcgatggc
ctggccgccgcgcaggccgcgggccgctggcaggccagcggtgcgagcgaggcgcgccgc
ctggctctgctgcccgagacactgccccagccgtgggacgacctcatggtgcagccagcg
tacatgcacgcgctggacctgctgccttga

DBGET integrated database retrieval system