KEGG   Acidovorax sp. JS42: Ajs_3386Help
Entry
Ajs_3386          CDS       T00455                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs01040  Biosynthesis of unsaturated fatty acids
ajs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ajs_3386
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Ajs_3386
Lipid biosynthesis proteins [BR:ajs01004]
 Desaturase
  First
   Ajs_3386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 CENP-F_leu_zip
Motif
Other DBs
NCBI-ProteinID: ABM43506
UniProt: A1WB81
Position
complement(3573304..3574515)
Genome map
AA seq 403 aa AA seqDB search
MLFDGAAWNTALDWLAHGVWDLAWWQIVLYTLATTHITIAAVTIFLHRSQAHRALDLGPV
PAHFFRFWLWLGTGMVTKEWVAIHRKHHAKCETPDDPHSPQTRGLRTVMWRGAELYRAEA
ANAETLKKFGHGTPDDWMERNVYSRFTWQGVGLMLVINLVLFGAVGAAVWAVQMAWIPFW
AAGVVNGVGHYWGYRNFEAQDASTNLVPWGLVIGGEELHNNHHTYPTAAKFSVKPYEFDV
GWLYISALQRLGWAKVKKVPPKLRLGAVKPVADEKTLEALIANRYEVMAGYARGVRQACK
DEIAALKARKADVSALKRAKRWLHRDAEKVPAQAQPTLAEVRAAHPVLDKMVTMREELRQ
LWLNTSQSRDQLTADLQAWCQRAEASGIAALKEFSLKLRAAHA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttgatggcgccgcgtggaataccgcgctcgactggctggcgcatggcgtgtgg
gacctggcctggtggcagatcgtgctctacaccctggccaccactcacatcacgatcgcg
gcggtgacgatcttcctgcaccgctcgcaggcgcaccgtgcgctggacctggggcctgtg
cctgcgcatttcttccgcttctggttgtggctgggcacgggcatggtcaccaaggaatgg
gtggccatccaccgcaagcaccacgccaagtgcgagacgcccgacgacccccacagcccg
cagacgcgcggcctgcgcaccgtgatgtggcgcggggccgagctgtaccgtgccgaggcg
gccaacgccgagacgctgaagaagttcggccatggcacgccggacgactggatggagcgc
aacgtctacagccgcttcacctggcagggcgtggggctgatgctggtcatcaacctggtg
ctgttcggcgccgtgggcgccgccgtgtgggccgtgcagatggcgtggatcccgttctgg
gccgcgggcgtggtcaacggcgtgggccactattggggttaccgcaacttcgaggcgcag
gacgcctccaccaacctcgtgccctggggccttgtgattggcggtgaagaactgcacaac
aaccaccacacctatccgacggccgcgaagttctcggtcaagccgtacgagttcgacgtg
gggtggctctacatcagcgcgttgcagcgcctgggctgggccaaggtcaagaaggtgccg
cccaagctgcgcctgggcgccgtgaagccggtggccgacgaaaagacgctggaggcgctc
atcgccaaccgctacgaggtcatggctggctatgcacgcggcgtgcgccaggcctgcaag
gacgagatcgccgcgctcaaggcgcgcaaggccgacgtgtcggccctcaagcgcgccaag
cgctggctgcaccgcgacgccgagaaggtccctgcgcaggcacagccgacgctggccgaa
gtgcgtgcggcgcaccccgtactcgacaagatggtcaccatgcgcgaggagctgcgccag
ctctggctcaacacctcgcagtcgcgcgatcagctgaccgcagacctgcaagcctggtgc
cagcgggccgaggccagcggcatcgcggcgctcaaggagttttcgctgaagctgcgggca
gcccacgcctga

DBGET integrated database retrieval system