KEGG   Acidovorax sp. JS42: Ajs_3505Help
Entry
Ajs_3505          CDS       T00455                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ajs_3505 (gpmA)
   01230 Biosynthesis of amino acids
    Ajs_3505 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_3505 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Ajs_3505 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ajs_3505 (gpmA)
Enzymes [BR:ajs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ajs_3505 (gpmA)
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ajs_3505 (gpmA)
  Exosomal proteins of melanoma cells
   Ajs_3505 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3700569..3701312
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKNAGRLLKAEGYDFDLAYTSVLKR
ATRTLWHCLDEMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPTDPRCERGDIRYAGLAPEQVPLTECLKDTVARVLPYWNEAIAPTIRSGKRVLIA
AHGNSIRALVKYLDGISDQDIVGLNIPNGIPLVYELDAELKPLRSYYLGDAEATAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgttctgatccgccacggcgaatccacgtggaatctggaaaaccgcttc
accggctggaccgatgtggatctgacccccacgggcatcgagcaggccaagaatgccggc
cgcctgctcaaggccgagggctacgattttgacctggcctacaccagtgtgctcaagcgc
gccacgcgcacgctgtggcactgcctggacgagatggaccgcacctggctgcccgtggag
cacagctggcgcctgaacgagcgccactacggcgctctgcagggcctgaacaaggccgac
atggccaagcagtatggcgacgcgcaagtgctggtctggcgccgcagctacgacacgccg
ccgccggccctggagcccaccgacccgcgctgcgagcgcggcgacatccgctacgcgggc
ctggcgcccgagcaggtgccgctgaccgagtgcctcaaggacacggtggcgcgcgtgctg
ccctactggaacgaagccatcgcgccaacgatccgctcgggcaagcgtgtgctgatcgca
gcgcacggcaactccatccgcgcgctggtcaagtacctggacggcatctccgaccaagac
atcgtgggcctgaacattcccaacggcattccgctggtgtacgagctggacgcggaactc
aagcccctgcgcagctactacctgggcgacgccgaggccaccgccaaggccgccgccgcc
gtggccgcgcagggcaaggcctga

DBGET integrated database retrieval system