KEGG   Acidovorax sp. JS42: Ajs_3651Help
Entry
Ajs_3651          CDS       T00455                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
ajs  Acidovorax sp. JS42
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ajs_3651
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ajs_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3860734..3861210)
Genome map
AA seq 158 aa AA seqDB search
MAVAGPAPATPAPAAPQPMAPDAAQLARGQQIYARCAGCHAIEGHRTGPQHCGLFGRRSG
TAPGFDGYSPAMKASGIVWDERTLQRFLKDPPATVPGTSMGYAGVKDDGERAALIAWLRS
RLHAQVTHCSAFDSCQRLLQKRWRHFWLEVRLVPWRRL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgccgggcccgctccggcaacgccagcgccggccgcgccccagcccatggcg
cctgacgcggcccagctggcgcgcggccagcagatctacgcgcgctgcgcggggtgccac
gccatcgagggccaccgcacgggaccgcagcactgcggcctgttcggccgccgctcgggc
acggcgccggggttcgacggctactccccggccatgaaggccagcggcatcgtctgggac
gagcgcacgctgcagcgcttcctgaaggacccgccagccaccgtgcccggcacgtccatg
ggctacgcaggcgtgaaggacgatggcgagcgtgcggcgctcatcgcctggctgcgcagc
cgcctgcacgcccaggtaacccattgctctgcctttgatagctgccagcgcttgctacaa
aagcgctggaggcatttttggcttgaagtgcggctggtgccatggcggcgcctatga

DBGET integrated database retrieval system