KEGG   Acidovorax sp. JS42: Ajs_3700Help
Entry
Ajs_3700          CDS       T00455                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ajs_3700
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Ajs_3700
DNA repair and recombination proteins [BR:ajs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Ajs_3700
    RecFOR pathway proteins
     Ajs_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 DNA_pol_lambd_f IMS_HHH 5_3_exonuc HHH_3
Motif
Other DBs
NCBI-ProteinID: ABM43811
UniProt: A1WC36
Position
complement(3919477..3920049)
Genome map
AA seq 190 aa AA seqDB search
MIGKLTGTLLEKNPPEVLVDCHGVGYEVQVSMSTFYNLPAVGERVSLLTQFIVREDAQLL
YGFGTAQERQAFRELIKISGVGPRTALSILSGMGVADLAQAVSLQEAGRLVKVPGIGKKT
AERLLLELKGKLGADVGVRAHAANDNQADILQALLALGYNDKEAAAALKALPADVGVSEG
IKLALKSLSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaattgaccggcacgctgctggaaaagaacccccccgaggtgctggtggac
tgccacggcgtgggctacgaggtgcaggtcagcatgagcaccttctacaacctgcccgcc
gtgggcgagcgggtgagcctgctcacgcagttcatcgtgcgcgaggatgcgcagttgctg
tacggctttggcacggcgcaggagcgccaggcgtttcgcgaactcatcaagatcagcggc
gtggggccgcgcacagcgctgtccatcctctcgggcatgggcgtggcggacctggcgcag
gccgtttcgctgcaggaagcagggcgcctggtcaaagtgccgggtatcggcaagaaaacc
gccgagcggctgctgctggagctgaaaggcaagctgggcgcggacgtcggcgtgcgcgcg
catgcggccaacgacaaccaggccgacatcctgcaggcgctgctggccctgggctataac
gacaaggaggccgccgctgcgctcaaggcgctgccggcggatgtgggagtgagcgagggg
atcaagctggcgctgaagtccctgtccaagtaa

DBGET integrated database retrieval system