KEGG   Acidovorax sp. JS42: Ajs_3867Help
Entry
Ajs_3867          CDS       T00455                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ajs_3867
   00565 Ether lipid metabolism
    Ajs_3867
   00590 Arachidonic acid metabolism
    Ajs_3867
   00591 Linoleic acid metabolism
    Ajs_3867
   00592 alpha-Linolenic acid metabolism
    Ajs_3867
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Ajs_3867
    3.1.1.32  phospholipase A1
     Ajs_3867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4108563..4109780
Genome map
AA seq 405 aa AA seqDB search
MPAVTDHAHHPTMTQPSHPLSRLGLATALLGTALPLVSWAETAAAPAVNRAAGWRQCAAL
TGDSQARLACFDQWAGEQSWQAPPASASAQPAAATQAPPPPVDATLPATRIIDVAQVDGC
RDGQYSTLSRFWELETGSDCGAFRFRGYWPMSVSVVGATSVNRLPTSGSPDNNATSEVDY
RKTEMRVQLSVRTKLAQGLLTRGHPTLRDSLWAGYTQQSYWQLFSPGISRPFRNTDHEPE
IMYVYPTDAKLPFGWRWRYSGIGLVHQSNGQSLPLSRSWNRVYLMTGMELDNRWTVTGRL
WKRLHESADSDDNPGISNYVGRAELGLTWNVDKDNTLALTARHSLGATGRGSARLEWLQT
LGTSLVGNRTNLRLHTQLFTGYGDSLIDYNRKRTVFSVGLSLVDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgtcaccgaccacgcgcatcatccgaccatgacacagccttcacaccccctg
tcccgcctgggcctggccaccgcgctgctgggcacggccctgccgctggtcagctgggcc
gaaaccgccgcagcccccgccgtcaaccgggcggccggctggcgccagtgcgccgccctc
accggtgacagccaggcacgcctggcctgctttgaccagtgggccggcgagcagagctgg
caggcgccgcccgcttcggccagcgcccagcccgccgccgccacgcaggcgccgcccccg
ccggtggacgccacgctgccggccacgcgcatcatcgacgtggcgcaggtggacggctgc
cgcgacggccagtacagcaccctgtcgcgcttctgggagctggagacgggcagcgactgc
ggggcgttccgctttcgcgggtactggcccatgagcgtgtccgtcgtgggcgccaccagc
gtcaaccgcctgcccacctcgggcagcccggacaacaacgccaccagcgaagtggactac
cgcaagaccgagatgcgcgtgcagctgtcggtgcgtaccaagctcgcgcagggcctgctc
acgcgcggccaccccacgctgcgcgactcgctgtgggcgggctacacgcagcagtcgtac
tggcagctgttctcgccgggcatctcgcggccgttccgcaacacggaccacgagcccgag
atcatgtacgtgtaccccaccgacgccaagctgcccttcggctggcgctggcgctacagc
ggcatcggcctggtgcaccagtccaacggccagagcctgccgctgtcgcgcagctggaac
cgcgtgtacctgatgaccggcatggagctggacaaccgctggaccgtcaccggccgcctg
tggaagcgcctgcacgagagcgcggacagcgacgacaaccccggcatcagcaactacgtg
ggccgggccgagctgggcctgacctggaacgtggacaaggacaacaccctggcgctgacc
gcacggcattcgctgggcgccaccgggcgcggctcggcacggctggaatggctgcaaacc
ctcggaaccagcctggtgggcaaccgcaccaacctgcgcctgcacacccagctgttcacg
ggctacggcgacagcctgatcgactacaaccgcaagcgcaccgtgttcagcgtgggcctg
agcctggtggatttctga

DBGET integrated database retrieval system