KEGG   Acidovorax sp. JS42: Ajs_3867Help
Entry
Ajs_3867          CDS       T00455                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ajs00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ajs00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ajs00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ajs00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ajs00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4108563..4109780
Genome map
AA seq 405 aa AA seqDB search
MPAVTDHAHHPTMTQPSHPLSRLGLATALLGTALPLVSWAETAAAPAVNRAAGWRQCAAL
TGDSQARLACFDQWAGEQSWQAPPASASAQPAAATQAPPPPVDATLPATRIIDVAQVDGC
RDGQYSTLSRFWELETGSDCGAFRFRGYWPMSVSVVGATSVNRLPTSGSPDNNATSEVDY
RKTEMRVQLSVRTKLAQGLLTRGHPTLRDSLWAGYTQQSYWQLFSPGISRPFRNTDHEPE
IMYVYPTDAKLPFGWRWRYSGIGLVHQSNGQSLPLSRSWNRVYLMTGMELDNRWTVTGRL
WKRLHESADSDDNPGISNYVGRAELGLTWNVDKDNTLALTARHSLGATGRGSARLEWLQT
LGTSLVGNRTNLRLHTQLFTGYGDSLIDYNRKRTVFSVGLSLVDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgtcaccgaccacgcgcatcatccgaccatgacacagccttcacaccccctg
tcccgcctgggcctggccaccgcgctgctgggcacggccctgccgctggtcagctgggcc
gaaaccgccgcagcccccgccgtcaaccgggcggccggctggcgccagtgcgccgccctc
accggtgacagccaggcacgcctggcctgctttgaccagtgggccggcgagcagagctgg
caggcgccgcccgcttcggccagcgcccagcccgccgccgccacgcaggcgccgcccccg
ccggtggacgccacgctgccggccacgcgcatcatcgacgtggcgcaggtggacggctgc
cgcgacggccagtacagcaccctgtcgcgcttctgggagctggagacgggcagcgactgc
ggggcgttccgctttcgcgggtactggcccatgagcgtgtccgtcgtgggcgccaccagc
gtcaaccgcctgcccacctcgggcagcccggacaacaacgccaccagcgaagtggactac
cgcaagaccgagatgcgcgtgcagctgtcggtgcgtaccaagctcgcgcagggcctgctc
acgcgcggccaccccacgctgcgcgactcgctgtgggcgggctacacgcagcagtcgtac
tggcagctgttctcgccgggcatctcgcggccgttccgcaacacggaccacgagcccgag
atcatgtacgtgtaccccaccgacgccaagctgcccttcggctggcgctggcgctacagc
ggcatcggcctggtgcaccagtccaacggccagagcctgccgctgtcgcgcagctggaac
cgcgtgtacctgatgaccggcatggagctggacaaccgctggaccgtcaccggccgcctg
tggaagcgcctgcacgagagcgcggacagcgacgacaaccccggcatcagcaactacgtg
ggccgggccgagctgggcctgacctggaacgtggacaaggacaacaccctggcgctgacc
gcacggcattcgctgggcgccaccgggcgcggctcggcacggctggaatggctgcaaacc
ctcggaaccagcctggtgggcaaccgcaccaacctgcgcctgcacacccagctgttcacg
ggctacggcgacagcctgatcgactacaaccgcaagcgcaccgtgttcagcgtgggcctg
agcctggtggatttctga

DBGET integrated database retrieval system