KEGG   Acidovorax sp. JS42: Ajs_4024Help
Entry
Ajs_4024          CDS       T00455                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ajs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ajs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4292764..4293405
Genome map
AA seq 213 aa AA seqDB search
MVQWRRVRAFCPPRHPCTMPRLTLPLLLCATLLGPAAQAADVAATPAVDAQACPALLQHT
VPRLQDEAPQALCQYAGKVLLVVNTASYCGFTGQYQGLEELYARYRDQGLVVLGFPSNDF
AQETGSNTEIAQFCENTFGVRFPMFAKSHVKGGEALPLYRQLAAASAGQTPRWNFHKYLV
SRSGKVVGSYGSSVEPHSKALIQAIEQQLAAPR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaatggcggcgtgtacgggctttttgccctccccgccatccctgcaccatgcca
cgcctgaccttgccgctgctcctatgcgccacgctgctgggccccgccgcccaggcggcg
gatgttgcggcgactcccgcagtagacgcccaggcctgccccgctctgctgcagcacacc
gtgccgcgcctgcaggacgaggcgccgcaggccttgtgccaatacgccggcaaggtgctg
ctggtggtcaacacggccagctactgcggcttcaccggccaataccagggcctggaagag
ctgtacgcgcgctaccgcgaccaagggctggtggtgctgggctttccgtcgaacgacttt
gcacaagaaaccggcagtaacaccgagatcgcccagttctgcgaaaacacgtttggcgtg
cgcttcccgatgtttgccaagagccacgtgaagggcggcgaagctctgccgctgtaccgc
cagctcgccgcagcgtccgcggggcagacgccacgctggaacttccacaagtacctggtc
agccgttcgggcaaggtggtgggaagctacggaagttcggtggaaccccacagcaaagcg
ctgatccaggccatcgagcagcaactggcggcgccgcgttga

DBGET integrated database retrieval system