KEGG   Acidovorax sp. JS42: Ajs_4024Help
Entry
Ajs_4024          CDS       T00455                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00480  Glutathione metabolism
ajs00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ajs_4024
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ajs_4024
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ajs_4024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABM44128
UniProt: A1WD03
Position
4292764..4293405
Genome map
AA seq 213 aa AA seqDB search
MVQWRRVRAFCPPRHPCTMPRLTLPLLLCATLLGPAAQAADVAATPAVDAQACPALLQHT
VPRLQDEAPQALCQYAGKVLLVVNTASYCGFTGQYQGLEELYARYRDQGLVVLGFPSNDF
AQETGSNTEIAQFCENTFGVRFPMFAKSHVKGGEALPLYRQLAAASAGQTPRWNFHKYLV
SRSGKVVGSYGSSVEPHSKALIQAIEQQLAAPR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaatggcggcgtgtacgggctttttgccctccccgccatccctgcaccatgcca
cgcctgaccttgccgctgctcctatgcgccacgctgctgggccccgccgcccaggcggcg
gatgttgcggcgactcccgcagtagacgcccaggcctgccccgctctgctgcagcacacc
gtgccgcgcctgcaggacgaggcgccgcaggccttgtgccaatacgccggcaaggtgctg
ctggtggtcaacacggccagctactgcggcttcaccggccaataccagggcctggaagag
ctgtacgcgcgctaccgcgaccaagggctggtggtgctgggctttccgtcgaacgacttt
gcacaagaaaccggcagtaacaccgagatcgcccagttctgcgaaaacacgtttggcgtg
cgcttcccgatgtttgccaagagccacgtgaagggcggcgaagctctgccgctgtaccgc
cagctcgccgcagcgtccgcggggcagacgccacgctggaacttccacaagtacctggtc
agccgttcgggcaaggtggtgggaagctacggaagttcggtggaaccccacagcaaagcg
ctgatccaggccatcgagcagcaactggcggcgccgcgttga

DBGET integrated database retrieval system