KEGG   Acidovorax sp. JS42: Ajs_4180Help
Entry
Ajs_4180          CDS       T00455                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ajs  Acidovorax sp. JS42
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pAOVO01:complement(17063..17812)
Genome map
AA seq 249 aa AA seqDB search
MIKRVLTLALAAALAVPAFAQDEAPASVVEKFKTMYPKTTFKEIRKSQVSGLYEVVMGEN
IAYTDESGRYFIFGHLFDMQQQVDLTAQRKLDSKKTEFPAQQLGQAIKTVKGDGSRILAV
FSDPDCPYCKQLEGELARLDNVTIYTFLYPLESLHPEAKTKAVSVWCAPNKAKAWSELML
AGKKPKLVACNNPVNDNLVLGSKLGVVGTPTLIAADGRVLPGSAPAEKIDQWLNAGKPGA
PAAAQEATQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgagtgttgaccctcgcgctggctgctgcgctggctgttcccgcatttgcc
caagatgaagcgcccgcgtccgtggtcgagaagttcaagaccatgtacccgaagacgacc
ttcaaggaaattcgcaagtcgcaagtttccgggctgtatgaggtagtgatgggcgagaac
atcgcctacaccgacgagtcgggccgctacttcattttcgggcacctgttcgacatgcag
cagcaagtcgatctgactgcccagcgcaagctcgatagcaagaaaaccgagttcccggca
cagcaacttggccaagcgatcaagacggtcaagggcgacggcagccgaatcctggccgtg
ttcagcgacccggattgcccctactgcaagcagttggagggcgagctggcccgcctggac
aacgtgaccatttacacgttcctgtacccgctcgaatcgctgcacccggaagccaagacc
aaggccgtcagcgtgtggtgcgcgccgaacaaggcgaaagcctggagcgagctgatgctg
gccggcaagaagcccaagctggtggcctgcaacaaccccgtcaacgacaacttggtgctg
ggttccaagctgggcgtggtgggcactcctaccctgattgcagccgatggccgtgtcctg
cctggctccgcaccggccgagaagatcgaccagtggctgaacgccggtaagcctggcgcg
ccggccgctgcgcaggaggcaacccaatga

DBGET integrated database retrieval system