KEGG   Acinonyx jubatus (cheetah): 106985735Help
Entry
106985735         CDS       T04657                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00561  Glycerolipid metabolism
aju01100  Metabolic pathways
aju04714  Thermogenesis
aju04723  Retrograde endocannabinoid signaling
aju04923  Regulation of lipolysis in adipocytes
Module
aju_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    106985735 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    106985735 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    106985735 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    106985735 (MGLL)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106985735 (MGLL)
Peptidases [BR:aju01002]
 Serine Peptidases
  Family S33
   106985735 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Peptidase_S9 Abhydrolase_5 Thioesterase PGAP1 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 106985735
NCBI-ProteinID: XP_014939411
Position
Un
AA seq 346 aa AA seqDB search
MPPCDRRDEGTALICLALILHAVVVVECKSQDMMETGLGDPFRMPEESSPRQTPQSVPYQ
DLPHLVNADGQYLFCRYWKPTGTPKALIFMSHGAGEHCGRYDELAQMLVGLELLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDIMQKDYPGLPVFLLGHSMGGAITILTAAERPG
LFSGMVLISPLVLASPESATTFKVFAAKVLNLVLPNMSLGPIDSSVLSRNKTEVDIYNAD
PLICRAGLKVCFGNQLLNAVTRVERALPKLTLPFLLLQGSADRLCDSKGAYLVMESSKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTAAAGKRSPL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgtgaccgccgagatgagggaacagcccttatttgcctggctctgattctc
catgctgtcgtggttgtggaatgcaaaagccaggacatgatggaaacaggacttggagat
cctttcagaatgccggaggaaagttctcccaggcagaccccacagagcgttccataccag
gacctgcctcacctggtcaatgccgatggacagtacctcttctgcaggtactggaaacct
acgggcacacccaaggccctcatctttatgtcccatggagccggggagcactgtggccgc
tatgacgagctggctcagatgctggtggggctcgagctgctggtgttcgcccacgaccat
gttggccatggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcatc
agggatgtgctacagcacgtggatatcatgcagaaagactacccagggcttcctgtgttc
ctgctgggccactccatgggaggtgccatcaccatccttacagccgcagagagaccgggc
ctcttctccggcatggtcctcatttcgcctttggttcttgccagtcctgagtctgcaaca
actttcaaggtctttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccaatcgactccagcgtgctctctcggaataagacggaggtcgacatttataatgcggac
cccctcatctgccgggcgggactgaaggtgtgcttcggcaaccagctgctcaatgccgtc
acgcgggtggagcgggcccttcccaagctgaccttgcccttcctgctgctccagggctct
gccgaccgcctttgtgacagcaaaggggcctacctggtcatggagtcctccaagagccag
gacaagacactcaagatttacgaaggtgcctaccacgttctccacaaagagcttccagaa
gtaaccaactccgtcttccacgaaataaacatgtgggtctcccaaaggacagcagccgcg
ggaaagcggtccccgctctga

DBGET integrated database retrieval system