KEGG   Advenella kashmirensis: TKWG_01765Help
Entry
TKWG_01765        CDS       T02117                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aka  Advenella kashmirensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TKWG_01765
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TKWG_01765
   00630 Glyoxylate and dicarboxylate metabolism
    TKWG_01765
Enzymes [BR:aka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TKWG_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296137..298014
Genome map
AA seq 625 aa AA seqDB search
MTDRTQVHSLQIATVLKNFVDQEALPGTGVDADAFWKGLDALINDLAPENKALLAERDRI
QAKMDEWYRQHPGKIADMQAYKAYLKEIGYLKDAPDTVQVNTSNVDYEITNQAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDALSEDDGATRDGGYNPKRGEKVIAFARDFLDQTI
PLQSGSHKDATAYTAENGTLSVTLADGSKTTLADADLYLGHPGDAAAPEALIFRQNGLHF
EVQIDKSNPIGKQDKAGVKDVLLEAALSTIMDCEDSIAAVDAEDKVLVYRNWLGLMNGTL
AEEVSKGGKTFTRKLNPDRQYTGKDGKPATLAGRSLMFIRNVGHLMTNPAILDKDGNETP
EGILDAVFTTLVAMHDLKREGGNSRKGSIYIVKPKMHGPDEVAFASKLFGRTEQLLGLAP
NTIKMGVMDEERRTSANLKACIAAAADRVAFINTGFLDRTGDEMHTSMEAGPMIRKGDMK
KSSWIDAYEKRNVLFGLACGLQGKSQIGKGMWAMPDLMADMLAQKGAQLKAGANTAWVPS
PTAATLHALHYHQTDVVQVQNSLKNDTDERLDALLTIPVADNTNWSDAEKQQELDNNARA
SWGTWCVGLTRVLAAPKCPISITLA
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgtacccaggttcacagccttcagatcgccaccgtgctgaaaaatttcgtt
gatcaggaagccctgccgggcactggcgtagacgccgatgcgttctggaaaggactggat
gcgctcatcaatgatctggcgccggaaaataaggcattgctggccgaacgcgaccgtatc
caggccaaaatggatgagtggtaccgtcagcatccgggcaagattgccgacatgcaggcc
tataaagcctatctgaaggaaatcggctatctgaaagacgcacctgataccgtgcaggtc
aataccagtaacgtcgattacgaaattaccaatcaggccggcccgcaactggtcgtaccc
attaccaacgcccgttatgcgctgaacgctgccaatgcgcgttggggtagcctgtatgac
gccctgtacggcaccgatgcactgagcgaagacgacggcgcgacgcgcgatggcggctat
aaccccaagcgcggcgagaaggtgattgcctttgcccgtgacttcctggatcagaccatt
ccgctgcaaagcggttcgcacaaggatgccacagcctacaccgcagaaaacggcacgctc
tcagtgaccctggccgacggcagcaaaacaacgctggccgacgcagacctgtatctgggc
cacccgggtgatgcggcagcccccgaggcgctgattttccgccagaacggcttgcatttt
gaagtgcagatcgacaaatccaatcctatcggcaaacaggacaaggcgggcgtcaaggat
gttttgcttgaggctgcactgtccaccatcatggactgcgaagactcaattgcggctgtg
gatgccgaagacaaagtgctggtgtatcgcaattggctgggtctgatgaacggcacgctg
gccgaagaagtgtcaaaaggcggcaaaaccttcacccgtaaactcaatccagaccgccag
tacaccggtaaggatggcaaaccggctacgctggccggtcgctcgctcatgttcattcgc
aacgtgggccacctgatgaccaatccggccattctggacaaggacggtaatgaaacgccc
gaaggcatcctggatgcggtatttaccacgcttgtcgccatgcacgatctgaaacgtgaa
ggcggtaattcgcgcaagggttctatctacattgtgaaacccaaaatgcacgggcctgat
gaagtggcgtttgccagcaagctgttcggccggaccgagcaattgcttgggttggcgccc
aacaccatcaaaatgggcgtgatggatgaagagcgtcgcaccagcgccaacctgaaggcg
tgtattgctgctgcggccgatcgcgtcgcgttcattaacaccgggttcctggatcgtacc
ggtgacgaaatgcacacatccatggaagcgggccccatgattcgcaaaggggatatgaaa
aaatcgtcctggatcgatgcctacgaaaaacgcaacgtgctgtttggcctggcttgcggg
ctgcagggcaagtcgcagatcggcaagggcatgtgggccatgcccgacctgatggccgat
atgctggcgcaaaaaggcgcgcaactgaaggctggcgccaatacggcatgggtgccttct
ccaacggcggccaccctgcatgcgcttcactaccatcagaccgatgttgtgcaagtgcag
aacagcctgaaaaatgacaccgacgagcgtcttgacgccttgctgaccatcccggttgcc
gacaacaccaactggtccgacgccgagaaacagcaggaactggacaacaacgccagggca
tcctggggtacgtggtgcgttgggttgaccagggtgttggctgctccaaagtgcccgata
tccataacgttggcctga

DBGET integrated database retrieval system