KEGG   Advenella kashmirensis: TKWG_03065Help
Entry
TKWG_03065        CDS       T02117                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aka  Advenella kashmirensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aka00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531384..532868
Genome map
AA seq 494 aa AA seqDB search
MDYLLALDQGTSSSRSILFDRNGQIVGLAQQEFTQHYPQSGWVEHDALEIWRTQLVTMQK
VLHQSAVDIARVRAVGITNQRETSVLWDRATGQPLGPAIVWQDRRGEPLCRQLRDQGHEP
MILEKTGLRLDAYFSATKLAWMLEHLPQARARADKGELLFGTIDSWLIWQLTGGKVHATD
VTNASRTMLFNVHTGQWDSQLLDLFQIPPSLLPQVMPSSAHYGDIPADLLGYALPICGVA
GDQHSALFGQACTRAGMAKNTYGTGCFALLHTGTRFTASENGLLTTRVAQYGQQQPEFAL
EGSVFVAGAAVQWLRDGLGIIKRSRDVQALAQSVPDTGGVMFVPAFTGLGAPYWKADARG
TLVGINRATTAAHIARAAVESIAYQSAALLSAMARDGVGLEQLRVDGGASVNDALMQFQA
DLLGIPVLRPQVVETTALGAAYLAGLQSGIWSDVEQIEQLWRIDKTFEPAMSRDQAQACM
QQWEKAVAQTICGT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggattatctgctggcgctagatcagggaacgtccagttcccgcagcattttatttgat
cgcaacgggcaaattgtgggccttgcccagcaggagtttacgcagcattatccccagtcg
ggctgggttgagcacgatgcgcttgaaatctggcgtactcagctggttaccatgcaaaag
gtgttacaccagagcgcggtagacattgccagggtgcgtgccgtgggcattaccaaccaa
cgcgagacatcggtgctgtgggatcgtgctacaggccagcccctggggccggcaattgtg
tggcaggatcgccggggcgaaccgttatgccgccagctgcgcgatcaggggcacgaaccc
atgattctggagaaaaccggcctgcgcctggatgcgtacttttctgcgaccaagctggcc
tggatgctggagcatctgccgcaggccagggcgcgtgccgacaaaggcgaactgctattc
ggcactatcgacagttggctgatctggcaactgaccgggggcaaggtacacgccaccgat
gtgaccaatgcgtcgcgcaccatgctgttcaatgtgcatacgggacagtgggattctcag
ttgctggatctattccagattccccccagtcttctgccgcaggtaatgccctccagcgcc
cactatggcgatatccctgccgacctgctgggttatgcgctgcctatttgtggtgtggcg
ggcgatcagcatagtgcgctttttggccaggcgtgcacgcgggccggaatggctaaaaat
acctatggtaccggttgttttgccctgttgcacaccggcacgcgctttaccgcttctgaa
aatggactgcttacgactcgggttgcgcaatatggccagcaacagccggagttcgcgctg
gaaggcagcgtttttgtggccggcgcggccgtgcagtggctgcgtgacgggcttgggatt
attaaaagaagccgggatgtgcaggcgctggcccagtcggtacccgatacgggaggcgtt
atgttcgtccctgcctttaccggcctgggtgcgccatattggaaggccgacgcccgcgga
acgctggtcggcatcaatcgcgccacgactgctgcgcacatcgcccgtgctgcggtcgag
agcattgcctatcagagtgccgcactgctgtcggccatggcgcgtgacggcgtggggctg
gagcaactacgggtggatggcggcgccagcgtcaacgatgcgctgatgcagtttcaggcc
gatctgctgggcatcccggtgttacgtccgcaagtggtggaaacaactgcgttgggcgct
gcgtatctggcgggcctgcaaagtggcatttggtcagacgttgagcagattgaacagctg
tggcgtatcgataaaacctttgagccggccatgagccgcgaccaggcgcaggcgtgcatg
cagcagtgggaaaaggcggttgcgcaaacgatttgcggcacctga

DBGET integrated database retrieval system