KEGG   Advenella kashmirensis: TKWG_03160Help
Entry
TKWG_03160        CDS       T02117                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aka  Advenella kashmirensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TKWG_03160 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    TKWG_03160 (hisD)
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TKWG_03160 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549152..550234
Genome map
AA seq 360 aa AA seqDB search
MQAALDALAPASRQALEQAAQRVRMYHDRQKAESWQYQEADGTVLGQKITPMDRVGLYVP
GGKAAYPSSVLMNAIPAKVAGVGEVIMVTPTPDGSRNPLVLAAAAVAGVDRVVAIGGAQA
VGALAYGTDSIAAVDKIVGPGNAYVAAAKRRVFGTVGIDMVAGPSEILIICDGTTPADWI
AMDLFSQAEHDELAQAILLCPDAGFLEQVQEAIERLLPTMPRAQILAKSLSDRGALILVQ
DLDEAVSIANEIAPEHLEISTENAPALAEKIRHAGAIFLGRFSSEALGDYCAGPNHVLPT
ARTARFSSPLGVYDFQKRSSIIQVSEAGAITLGAIAAELADGEGLAAHAQSARYRLNTTT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggctgcgctggatgcgcttgcgcccgcaagtcgtcaggcgctggagcaggcagcg
caacgtgtgcgcatgtatcatgatcggcagaaagccgaatcctggcagtatcaggaagca
gacggtacggtgctgggtcaaaaaattacccccatggaccgcgtcgggctctacgtgccc
ggcggcaaggcggcctatccctcttcggtgctgatgaacgccattccggccaaggtggcc
ggggtgggcgaagtgatcatggttacacccacgcccgacggctcgcgtaatccgctggta
ctggccgctgccgccgtggctggcgttgatcgcgtggttgccatcggcggtgcccaggcg
gtaggagcgctggcttatggcaccgacagcattgccgccgtggataaaattgtcggccct
ggcaacgcctatgtggccgcagccaagcgccgggtattcggtacggtaggcattgatatg
gtcgccggccccagcgagattctgattatctgtgacggcaccacgccggcagactggatc
gccatggatctgttttcccaggccgagcatgatgaactggcccaggccattttgctgtgt
cccgatgccggtttcctggaacaagtgcaggaggcgatcgaacgcctgctgcccaccatg
ccgcgtgcccagatcctggccaaaagcctgtctgatcgaggcgcattgattctggtgcaa
gaccttgatgaggcagtttctattgcaaatgaaattgcacccgagcatcttgaaatttcc
accgaaaatgcgccagcgcttgccgagaaaattcgccatgctggtgcgatttttcttggc
cgtttttcgtccgaagcgctgggagactattgcgccggacccaaccacgtgctgcccaca
gcgcgtaccgcccgcttttcctcgccgctgggcgtctatgattttcagaaacgcagcagt
attatccaggtgtccgaggcaggagcgattacactaggggcgattgccgctgaactggcc
gatggcgaaggcctcgctgcgcacgcgcagagcgcgcgctaccgcctgaacactactacc
tga

DBGET integrated database retrieval system