KEGG   Advenella kashmirensis: TKWG_03510Help
Entry
TKWG_03510        CDS       T02117                                 

Definition
thiol:disulfide interchange protein (periplasmic)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aka  Advenella kashmirensis
Brite
Enzymes [BR:aka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TKWG_03510
Secretion system [BR:aka02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TKWG_03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602921..603682
Genome map
AA seq 253 aa AA seqDB search
MGLNWINARTVQRYQRAALAGLLTLAAGAFAVPAVQAQTADNAKLESVREAVKKAFDVEV
TRVQPTDYANLYEVQLGGNIVYTNEKAEFVLAGNLVDAKTKRDVTTERIEEISKVDFSTL
PLAQAVKLVKGSGARKMAVFEDPNCGYCKKLHKELATMDNVTVYTFLFPILAPDSVTKAN
NVWCAKDQATVWTDWMNKGVEPPEATCETPIEKNLALGQKLAVQGTPAIFFESGTRINGY
VPAARLNQELDRK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggattgaattggataaacgcacgcaccgtgcagcggtaccaacgggcggcgctggca
ggcttgctgacgctggccgcaggtgcttttgccgtgccggcggtacaggcacaaacggct
gataatgcaaagctggaaagcgttcgggaagcagtcaaaaaggccttcgatgttgaagtg
acccgcgttcagccgaccgattatgccaatctgtatgaagtgcaactgggtggcaatatc
gtgtataccaacgaaaaggccgagtttgtgctggccggcaatctggtcgacgccaaaaca
aaacgcgatgtaaccaccgagcggatcgaggaaatttccaaagtggatttttccaccttg
ccactggctcaggcagtcaagctggtcaaggggagcggtgcgcgcaagatggccgtgttc
gaggatcccaactgcggctattgcaaaaaactgcataaggaactggcgacgatggataac
gtcaccgtgtatacctttctgtttcccatcctggcacccgattctgtgaccaaagccaac
aacgtatggtgcgccaaagaccaggccactgtatggacagactggatgaacaagggtgtt
gaaccgcctgaggctacctgcgagacacccatcgagaaaaatctcgccttgggccagaaa
ctggctgtccagggtacgcctgccatcttctttgaaagtggtactcgcatcaacggctat
gtaccggccgcccggctcaatcaggaactggatcgcaagtga

DBGET integrated database retrieval system