KEGG   Advenella kashmirensis: TKWG_04750Help
Entry
TKWG_04750        CDS       T02117                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aka  Advenella kashmirensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TKWG_04750 (gpmA)
   01230 Biosynthesis of amino acids
    TKWG_04750 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_04750 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    TKWG_04750 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_04750 (gpmA)
Enzymes [BR:aka01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TKWG_04750 (gpmA)
Exosome [BR:aka04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TKWG_04750 (gpmA)
  Exosomal proteins of melanoma cells
   TKWG_04750 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821428..822180
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWKDVDLTETGRQQAWEAGELLKKEGYTFDLAFTSVLKR
AIRTLWIALDAMDAMYTPVHPSWRLNERHYGALQGLNKAETAQKYGDEQVLVWRRAYAIA
PEPLDGDDERHPRFDARYSRIAPADLPATECLKDTVERVLPLWNDSIAPAIKAGRNVLIS
AHGNSLRALIKHLDQVSEDDIVNLNIPTGQPLVYELDENLKPIKHYYLGDQEAIAAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataagctagtgttaatgcgccatggcgaaagccagtggaatcttgaaaaccggttt
accggctggaaagacgtcgatctgactgaaaccggccgtcagcaggcctgggaagccggc
gagctgctcaaaaaagaaggctacaccttcgatctggcattcacatctgtgttaaaacgc
gccatccgcaccctctggattgcgctggatgccatggatgccatgtacacgcctgtgcat
ccgagctggcgcctgaatgaacggcactatggcgcgttgcagggcctgaacaaggcggaa
acggcgcagaaatatggcgatgagcaggtgctggtatggcgccgggcttatgccattgcg
cccgagccgctggacggtgatgacgaacgtcatccgcgctttgatgcgcgctatagccgc
attgccccagccgatctgcccgcaaccgaatgcctgaaagataccgtggagcgggtcctg
cctttatggaatgactctattgcgccggcgatcaaggccggtcgcaatgtgcttatttca
gctcacggcaatagcctgcgtgcgttgatcaagcatctggatcaggtctccgaagacgat
atcgtcaatctgaatatccctaccggccagccgctggtctatgagctcgatgagaacctc
aagcctatcaagcactactatctgggcgatcaggaagccatcgctgcggccatggctgct
gttgcggcccagggaaaggctaaaaaggactga

DBGET integrated database retrieval system