KEGG   Advenella kashmirensis: TKWG_06130Help
Entry
TKWG_06130        CDS       T02117                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aka  Advenella kashmirensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aka01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aka00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1058771..1059937)
Genome map
AA seq 388 aa AA seqDB search
MSDFVSSVATARRIVVKVGSSLLTNNGQGLDPQAIGEWSSQIATLCRQNKQVILVSSGAI
AEGMARLKWKTRPKAMSELQAAAAVGQMGLIQAYESAFAAHNMRAAQILLTHEDLTDRLR
YLNARSTIFKLLELGVIPIVNENDTVVTDEIRLGDNDTLGAVVSNLIEADALIILTDQRG
LYDSDPRNNPDARFIHLATAGDPALQKMAGGAGSHIGTGGMLTKVLAAQRAASSGATTII
ASGREERVLERLGQGEAIGTELRASPSLRSARKQWMADHLRLPGKLVLDEGACKALVDQG
KSLLAVGVTDVIGEFERGDVVACTDQQHREIARGLTNYSSAETRRIMRHPTREIESILGN
CRDEELIHRNNMVLVHPPQNTTSDASQI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttcgtttcttcagtggccacggcaaggcgtatcgtcgtcaaagtgggctca
tccctgcttaccaacaatggtcagggcctggacccgcaggccatcggagaatggtcatcg
caaatcgccaccctgtgtcgccagaacaagcaagtgattctggtgtccagcggcgccatt
gccgaaggcatggcgcgcctgaagtggaaaacccgtcccaaagccatgagcgagctgcag
gctgctgccgcggtgggccagatgggtctgatccaggcctatgaatcagctttcgctgcg
cacaatatgcgcgcggcgcaaatcctgctgacccacgaagatttgaccgatcgcctgcgc
tatctgaatgcgcgctcgaccatctttaaactgctcgaactgggtgtgatcccgatcgtc
aatgaaaacgatacggtggtcacggacgaaatccgcctgggggacaacgacacgctgggc
gccgtagtcagcaatctgatcgaagcggacgcgctgatcattctgacggatcagcgcggg
ctatacgacagcgacccgcgtaacaaccccgacgcccgctttatccatctggccacggcc
ggtgatccggcgctgcagaaaatggccgggggtgccggcagccatatcggcactggcggc
atgctgaccaaggttctggccgctcaacgggccgccagtagcggcgctaccaccattatc
gcgtccggccgcgaggagcgcgtcctggagcgactgggccagggcgaagccatcggcacc
gaattgcgtgcctcgccgtctttgcgctctgcacgcaagcaatggatggccgaccatttg
cgcctgcccggcaagctggtgctggacgaaggtgcatgcaaagcgctggtcgaccagggt
aaaagcctgctggctgtcggcgtgaccgatgtcatcggtgaatttgagcgcggcgatgtc
gtggcctgcaccgatcagcagcatcgtgaaattgcgcgcggactcaccaattattcttcg
gccgaaacccgccggatcatgcgacacccgacccgtgaaatcgaaagcattcttggcaat
tgccgcgacgaagaactgatccaccgcaataacatggtgctcgttcacccgccgcaaaat
accacttccgatgcttcccaaatttaa

DBGET integrated database retrieval system